Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1647
Gene name Gene Name - the full gene name approved by the HGNC.	Growth arrest and DNA damage inducible alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GADD45A
Synonyms (NCBI Gene) Gene synonyms aliases	DDIT1, GADD45
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p31.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activatio

Show/Hide all(200)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005574	hsa-miR-374a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	21274007
MIRT016251	hsa-miR-504-5p	qRT-PCR	20542001
MIRT029880	hsa-miR-26b-5p	Microarray	19088304
MIRT039859	hsa-miR-615-3p	CLASH	23622248
MIRT195823	hsa-miR-4282	PAR-CLIP	23592263
MIRT075736	hsa-miR-4678	PAR-CLIP	23592263
MIRT195824	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT195818	hsa-miR-5681b	PAR-CLIP	23592263
MIRT195820	hsa-miR-331-5p	PAR-CLIP	23592263
MIRT488305	hsa-miR-5701	PAR-CLIP	23592263
MIRT075723	hsa-miR-135b-3p	PAR-CLIP	23592263
MIRT488304	hsa-miR-607	PAR-CLIP	23592263
MIRT260128	hsa-miR-148b-3p	Next Generation Sequencing (NGS), qRT-PCR	27505319
MIRT734985	hsa-miR-4270	Western blotting, qRT-PCR	33042452
MIRT005574	hsa-miR-374a-5p	Western blotting, RNA-seq, Immunofluorescence, qRT-PCR	32269736
MIRT195823	hsa-miR-4282	PAR-CLIP	23592263
MIRT075736	hsa-miR-4678	PAR-CLIP	23592263
MIRT195824	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT195818	hsa-miR-5681b	PAR-CLIP	23592263
MIRT195820	hsa-miR-331-5p	PAR-CLIP	23592263
MIRT488305	hsa-miR-5701	PAR-CLIP	23592263
MIRT075723	hsa-miR-135b-3p	PAR-CLIP	23592263
MIRT488304	hsa-miR-607	PAR-CLIP	23592263
MIRT1010189	hsa-miR-1237	CLIP-seq
MIRT1010190	hsa-miR-1248	CLIP-seq
MIRT1010191	hsa-miR-130a	CLIP-seq
MIRT1010192	hsa-miR-130b	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT1010196	hsa-miR-301a	CLIP-seq
MIRT1010197	hsa-miR-301b	CLIP-seq
MIRT1010198	hsa-miR-3074-5p	CLIP-seq
MIRT1010199	hsa-miR-3666	CLIP-seq
MIRT1010200	hsa-miR-3667-3p	CLIP-seq
MIRT1010201	hsa-miR-374c	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT1010204	hsa-miR-4295	CLIP-seq
MIRT1010205	hsa-miR-454	CLIP-seq
MIRT1010206	hsa-miR-4778-3p	CLIP-seq
MIRT1010207	hsa-miR-4799-5p	CLIP-seq
MIRT1010208	hsa-miR-5096	CLIP-seq
MIRT1010209	hsa-miR-516a-3p	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT1010214	hsa-miR-579	CLIP-seq
MIRT1010215	hsa-miR-655	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1010189	hsa-miR-1237	CLIP-seq
MIRT1010190	hsa-miR-1248	CLIP-seq
MIRT1010217	hsa-miR-3124-3p	CLIP-seq
MIRT1010206	hsa-miR-4778-3p	CLIP-seq
MIRT1010208	hsa-miR-5096	CLIP-seq
MIRT1010214	hsa-miR-579	CLIP-seq
MIRT1010218	hsa-miR-587	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT1010189	hsa-miR-1237	CLIP-seq
MIRT1010190	hsa-miR-1248	CLIP-seq
MIRT1010191	hsa-miR-130a	CLIP-seq
MIRT1010192	hsa-miR-130b	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT2232886	hsa-miR-2276	CLIP-seq
MIRT2232887	hsa-miR-296-5p	CLIP-seq
MIRT1010196	hsa-miR-301a	CLIP-seq
MIRT1010197	hsa-miR-301b	CLIP-seq
MIRT1010217	hsa-miR-3124-3p	CLIP-seq
MIRT2232888	hsa-miR-3545-3p	CLIP-seq
MIRT2232889	hsa-miR-361-3p	CLIP-seq
MIRT1010199	hsa-miR-3666	CLIP-seq
MIRT2232890	hsa-miR-3680	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT1010204	hsa-miR-4295	CLIP-seq
MIRT1010205	hsa-miR-454	CLIP-seq
MIRT2232891	hsa-miR-4680-5p	CLIP-seq
MIRT2232892	hsa-miR-4703-3p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2232893	hsa-miR-4772-3p	CLIP-seq
MIRT2232894	hsa-miR-512-5p	CLIP-seq
MIRT1010209	hsa-miR-516a-3p	CLIP-seq
MIRT2232895	hsa-miR-518a-5p	CLIP-seq
MIRT2232896	hsa-miR-527	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT1010218	hsa-miR-587	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1010191	hsa-miR-130a	CLIP-seq
MIRT1010192	hsa-miR-130b	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT1010196	hsa-miR-301a	CLIP-seq
MIRT1010197	hsa-miR-301b	CLIP-seq
MIRT1010199	hsa-miR-3666	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT1010204	hsa-miR-4295	CLIP-seq
MIRT1010205	hsa-miR-454	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536562	hsa-miR-1273e	CLIP-seq
MIRT2536563	hsa-miR-1283	CLIP-seq
MIRT2536564	hsa-miR-1321	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT2536565	hsa-miR-2054	CLIP-seq
MIRT2536566	hsa-miR-299-5p	CLIP-seq
MIRT1010198	hsa-miR-3074-5p	CLIP-seq
MIRT2536567	hsa-miR-3143	CLIP-seq
MIRT2536568	hsa-miR-3162-5p	CLIP-seq
MIRT2536569	hsa-miR-3607-3p	CLIP-seq
MIRT2536570	hsa-miR-362-5p	CLIP-seq
MIRT1010200	hsa-miR-3667-3p	CLIP-seq
MIRT2536571	hsa-miR-3686	CLIP-seq
MIRT1010201	hsa-miR-374c	CLIP-seq
MIRT2536572	hsa-miR-375	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT2536573	hsa-miR-4280	CLIP-seq
MIRT2536574	hsa-miR-4302	CLIP-seq
MIRT2536575	hsa-miR-4326	CLIP-seq
MIRT2536576	hsa-miR-4328	CLIP-seq
MIRT2536577	hsa-miR-4642	CLIP-seq
MIRT2536578	hsa-miR-4652-3p	CLIP-seq
MIRT2536579	hsa-miR-4690-3p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536580	hsa-miR-4739	CLIP-seq
MIRT2536581	hsa-miR-4756-5p	CLIP-seq
MIRT2536582	hsa-miR-4775	CLIP-seq
MIRT1010207	hsa-miR-4799-5p	CLIP-seq
MIRT2536583	hsa-miR-4803	CLIP-seq
MIRT2536584	hsa-miR-500a	CLIP-seq
MIRT2536585	hsa-miR-500b	CLIP-seq
MIRT2536586	hsa-miR-502-5p	CLIP-seq
MIRT2232894	hsa-miR-512-5p	CLIP-seq
MIRT2536587	hsa-miR-520d-5p	CLIP-seq
MIRT2536588	hsa-miR-524-5p	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT2536589	hsa-miR-548m	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT2536590	hsa-miR-590-3p	CLIP-seq
MIRT2536591	hsa-miR-606	CLIP-seq
MIRT1010215	hsa-miR-655	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536562	hsa-miR-1273e	CLIP-seq
MIRT2536563	hsa-miR-1283	CLIP-seq
MIRT2536564	hsa-miR-1321	CLIP-seq
MIRT2536565	hsa-miR-2054	CLIP-seq
MIRT2536566	hsa-miR-299-5p	CLIP-seq
MIRT1010198	hsa-miR-3074-5p	CLIP-seq
MIRT2536567	hsa-miR-3143	CLIP-seq
MIRT2536568	hsa-miR-3162-5p	CLIP-seq
MIRT2536569	hsa-miR-3607-3p	CLIP-seq
MIRT2536570	hsa-miR-362-5p	CLIP-seq
MIRT1010200	hsa-miR-3667-3p	CLIP-seq
MIRT2536571	hsa-miR-3686	CLIP-seq
MIRT1010201	hsa-miR-374c	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT2536573	hsa-miR-4280	CLIP-seq
MIRT2536574	hsa-miR-4302	CLIP-seq
MIRT2536576	hsa-miR-4328	CLIP-seq
MIRT2536577	hsa-miR-4642	CLIP-seq
MIRT2536578	hsa-miR-4652-3p	CLIP-seq
MIRT2536579	hsa-miR-4690-3p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536580	hsa-miR-4739	CLIP-seq
MIRT2536581	hsa-miR-4756-5p	CLIP-seq
MIRT2536582	hsa-miR-4775	CLIP-seq
MIRT1010207	hsa-miR-4799-5p	CLIP-seq
MIRT2536583	hsa-miR-4803	CLIP-seq
MIRT2536584	hsa-miR-500a	CLIP-seq
MIRT2536585	hsa-miR-500b	CLIP-seq
MIRT2536586	hsa-miR-502-5p	CLIP-seq
MIRT2232894	hsa-miR-512-5p	CLIP-seq
MIRT2536587	hsa-miR-520d-5p	CLIP-seq
MIRT2536588	hsa-miR-524-5p	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT2536589	hsa-miR-548m	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT2536590	hsa-miR-590-3p	CLIP-seq
MIRT2536591	hsa-miR-606	CLIP-seq
MIRT1010215	hsa-miR-655	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq

Transcription factors

Show/Hide all(13)

Transcription factor	Regulation	Reference
ATM	Activation	20164679
BRCA1	Activation	10962562;17428466;18025037
BRCA1	Repression	18350249
BRCA1	Unknown	11777930;12647291
JUND	Activation	17084916
NFYA	Activation	11525640
NFYA	Unknown	11420680
POU2F1	Activation	11525640
POU2F1	Unknown	11420680
POU5F1	Unknown	11704867
TP53	Activation	10566557
TP53	Repression	17344317;18350249
TP53	Unknown	10327059;12007564;15031557;16581545;18225552

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	10747892
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	23329839
GO:0005515	Function	Protein binding	IDA	20460379
GO:0005515	Function	Protein binding	IPI	12052864, 12716909, 15328371, 16189514, 17268471, 21722948, 21988832, 23820005, 32296183, 32814053, 33961781, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9827804
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9827804
GO:0006281	Process	DNA repair	TAS	7973727
GO:0006915	Process	Apoptotic process	TAS	10828065
GO:0006974	Process	DNA damage response	IEA
GO:0007098	Process	Centrosome cycle	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019900	Function	Kinase binding	IPI	20460379
GO:0033140	Process	Negative regulation of peptidyl-serine phosphorylation of STAT protein	IMP	23329839
GO:0042770	Process	Signal transduction in response to DNA damage	IMP	20160708
GO:0042803	Function	Protein homodimerization activity	IDA	20460379
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9827804
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IEA
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IMP	23329839
GO:0046330	Process	Positive regulation of JNK cascade	IDA	9827804
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20460379
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	10747892
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071479	Process	Cellular response to ionizing radiation	IMP	20160708
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	IMP	23329839
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	9827804
GO:1900745	Process	Positive regulation of p38MAPK cascade	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IMP	20160708

MIM	HGNC	e!Ensembl
126335	4095	ENSG00000116717

Protein

UniProt ID

P24522

Protein name

Growth arrest and DNA damage-inducible protein GADD45 alpha (DNA damage-inducible transcript 1 protein) (DDIT-1)

Protein function

In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and i

PDB

2KG4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01248	Ribosomal_L7Ae	21 → 123	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family	Domain

Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Sequence length

165

Interactions

View interactions

GADD45A (growth arrest and DNA damage inducible alpha)