Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
164656
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane serine protease 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMPRSS6
Synonyms (NCBI Gene) Gene synonyms aliases
IRIDA, MT2
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q12.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a type II transmembrane serine proteinase that is found attached to the cell surface. The encoded protein may be involved in matrix remodeling processes in the liver. Alternative splicing results in multiple transcript
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853119 C>T Pathogenic Coding sequence variant, missense variant
rs137853120 C>T Pathogenic Coding sequence variant, missense variant
rs137853121 G>T Pathogenic Coding sequence variant, stop gained
rs137853122 A>C Pathogenic Coding sequence variant, stop gained
rs137853123 G>A Pathogenic-likely-pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030016 hsa-miR-26b-5p Microarray 19088304
MIRT721887 hsa-miR-6798-5p HITS-CLIP 19536157
MIRT721886 hsa-miR-6742-3p HITS-CLIP 19536157
MIRT721885 hsa-miR-1266-5p HITS-CLIP 19536157
MIRT721884 hsa-miR-4518 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0004222 Function Metalloendopeptidase activity TAS
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 18976966, 19357398, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609862 16517 ENSG00000187045
Protein
UniProt ID Q8IU80
Protein name Transmembrane protease serine 6 (EC 3.4.21.-) (Matriptase-2)
Protein function Membrane-bound serine protease (PubMed:18976966, PubMed:20518742, PubMed:25156943, PubMed:25588876). Through the cleavage of cell surface hemojuvelin (HJV), a regulator of the expression of the iron absorption-regulating hormone hepicidin/HAMP,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01390 SEA 86 192 SEA domain Family
PF00057 Ldl_recept_a 490 525 Low-density lipoprotein receptor domain class A Repeat
PF00057 Ldl_recept_a 529 566 Low-density lipoprotein receptor domain class A Repeat
PF00089 Trypsin 577 806 Trypsin Domain
Sequence
MLLLFHSKRMPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLL
ALLVLASAGVLLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
MLKELITSTRLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRLMLSPEVVQALLVEELL
STVNSSAAVPYR
AEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDH
LASSCLWHLQGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVE
VLASGAIMAVVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYY
SPQTHCSWHLTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAE
RIPVVATAGITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDC
PNGLDERNCVCRATFQCKEDSTCISLPKVCDGQPDCLNGSDEEQCQEGVPCGTFTFQCED
RSCVKKPNPQCDGRPDCRDGSDEEHC
DCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRH
ICGGALIADRWVITAAHCFQEDSMASTVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYH
EEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGPISNAL
QKVDVQLIPQDLCSEVYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGL
VSWGLGCGRPNYFGVYTRITGVISWI
QQVVT
Sequence length 811
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Collagen degradation
Degradation of the extracellular matrix
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Anemia iron-refractory iron deficiency anemia rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs869320724, rs137853123, rs767094129, rs786205060, rs786205058, rs267607121, rs786205059, rs387907018 N/A
microcytic anemia Microcytic anemia rs1569024289, rs137853120, rs775869554, rs137853123 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Associate 23433094, 25557470, 30984307, 34444942
Anemia Hemolytic Associate 22509377, 24175968
Anemia hypochromic microcytic Associate 18596229
Anemia Iron Deficiency Associate 18408718, 18596229, 18603562, 19357398, 19818657, 20713458, 20966077, 21873547, 22581667, 23319530, 24782651, 24867957, 25557470, 25588876, 28447549
View all (6 more)
beta Thalassemia Associate 23144979
Carcinoma Hepatocellular Associate 30135444
Carcinoma Non Small Cell Lung Associate 35178045
Celiac Disease Associate 29194702, 34444942
Chemical and Drug Induced Liver Injury Associate 23144979
Chronic Disease Associate 23433094