Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	1645
Gene name	Aldo-keto reductase family 1 member C1
Gene symbol	AKR1C1
Synonyms (NCBI Gene)	2-ALPHA-HSD20-ALPHA-HSDC9DD1DD1/DD2DDHDDH1H-37HAKRCHBABMBAB
Chromosome	10
Chromosome location	10p15.1
Summary	This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT756094	hsa-miR-338-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)Immunofluorescence	38472205

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0004032	Function	Aldose reductase (NADPH) activity	IBA
GO:0004032	Function	Aldose reductase (NADPH) activity	IDA	21232532
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	8486699
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006066	Process	Alcohol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	NAS	8486699
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0007586	Process	Digestion	IDA	8486699
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	TAS	7789999
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008206	Process	Bile acid metabolic process	IDA	8486699
GO:0015721	Process	Bile acid and bile salt transport	TAS	8486699
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016655	Function	Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	19442656, 20837989
GO:0030299	Process	Intestinal cholesterol absorption	TAS	8486699
GO:0030855	Process	Epithelial cell differentiation	IDA	21492153
GO:0031406	Function	Carboxylic acid binding	IDA	8486699
GO:0032052	Function	Bile acid binding	IBA
GO:0032052	Function	Bile acid binding	IDA	8486699
GO:0032787	Process	Monocarboxylic acid metabolic process	IEA
GO:0033703	Function	3-beta-hydroxy-5-beta-steroid dehydrogenase (NADP+) activity	IEA
GO:0033764	Function	Steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	TAS
GO:0042445	Process	Hormone metabolic process	IEA
GO:0042448	Process	Progesterone metabolic process	IBA
GO:0042448	Process	Progesterone metabolic process	IDA	21232532
GO:0042574	Process	Retinal metabolic process	IDA	21851338
GO:0042632	Process	Cholesterol homeostasis	TAS	8486699
GO:0044597	Process	Daunorubicin metabolic process	IBA
GO:0044597	Process	Daunorubicin metabolic process	IMP	20837989
GO:0044598	Process	Doxorubicin metabolic process	IBA
GO:0044598	Process	Doxorubicin metabolic process	IMP	20837989
GO:0047006	Function	17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase [NAD(P)+] activity	IEA
GO:0047023	Function	Androsterone dehydrogenase [NAD(P)+] activity	IBA
GO:0047023	Function	Androsterone dehydrogenase [NAD(P)+] activity	IEA
GO:0047024	Function	5-alpha-androstane-3-beta,17-beta-diol dehydrogenase (NADP+) activity	IEA
GO:0047044	Function	Androstan-3-alpha,17-beta-diol dehydrogenase (NAD+) activity	IEA
GO:0047045	Function	Testosterone dehydrogenase (NADP+) activity	IEA
GO:0047086	Function	Ketosteroid monooxygenase activity	IBA
GO:0047086	Function	Ketosteroid monooxygenase activity	IDA	21232532
GO:0047115	Function	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity	IDA	8486699
GO:0047115	Function	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity	IEA
GO:0047718	Function	Indanol dehydrogenase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071395	Process	Cellular response to jasmonic acid stimulus	IDA	19487289
GO:0140169	Function	3-alpha-hydroxysteroid 3-dehydrogenase [NAD(P)+] activity	IDA	8486699
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	19442656

MIM	HGNC	e!Ensembl
600449	384	ENSG00000187134

Q04828

Protein name

Aldo-keto reductase family 1 member C1 (EC 1.1.1.-) (EC 1.1.1.112) (EC 1.1.1.209) (EC 1.1.1.210) (EC 1.1.1.357) (EC 1.1.1.51) (EC 1.1.1.53) (EC 1.1.1.62) (EC 1.3.1.20) (20-alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (EC 1.1.1.149) (Chlordecone redu

Protein function

Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids (PubMed:19218247). Most probably acts as a reductase in vivo since the oxidase activity measured in vitro is inhibited by phys

PDB

1MRQ , 3C3U , 3GUG , 3NTY , 4YVP , 6A7A , 6IJX , 8JP2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00248	Aldo_ket_red	18 → 301	Aldo/keto reductase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain. {ECO:0000269|PubMed:10998348, ECO:0000269|PubMed:

Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY

Sequence length

323

Interactions

View interactions

	KEGG		Reactome
	Steroid hormone biosynthesis Metabolism of xenobiotics by cytochrome P450 Metabolic pathways Chemical carcinogenesis - reactive oxygen species		Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol Synthesis of bile acids and bile salts via 24-hydroxycholesterol Synthesis of bile acids and bile salts via 27-hydroxycholesterol Retinoid metabolism and transport

AKR1C1 (aldo-keto reductase family 1 member C1)