Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
163702
Gene name Gene Name - the full gene name approved by the HGNC.
Interferon lambda receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IFNLR1
Synonyms (NCBI Gene) Gene synonyms aliases
CRF2/12, IFNLR, IL-28R1, IL28RA, LICR2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, in
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024759 hsa-miR-215-5p Microarray 19074876
MIRT026809 hsa-miR-192-5p Microarray 19074876
MIRT710804 hsa-miR-519a-3p HITS-CLIP 19536157
MIRT710803 hsa-miR-519b-3p HITS-CLIP 19536157
MIRT710802 hsa-miR-519c-3p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
STAT1 Unknown 20372826
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002385 Process Mucosal immune response IEA
GO:0002385 Process Mucosal immune response ISS
GO:0004896 Function Cytokine receptor activity IBA
GO:0004896 Function Cytokine receptor activity NAS 12483210
GO:0005515 Function Protein binding IPI 12469119, 12483210, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607404 18584 ENSG00000185436
Protein
UniProt ID Q8IU57
Protein name Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (L
Protein function The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimula
PDB 3OG4 , 3OG6 , 5IXD , 5IXI , 5L04 , 5T5W , 9BPU , 9BPV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01108 Tissue_fac 8 111 Tissue factor Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12469119, ECO:0000269|PubMed:12483210}.
Sequence
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQ
SSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPW
VESEYLDYL
FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQ
PVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWAFLVLPSLLILLL
VIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQPSRPESVNDLFLCPQKELTR
GVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFLGQEHQAPGHS
EAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDG
HQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSP
EEEEEARESEIEDSDAGSWGAESTQRTEDRGRTLGHYMAR
Sequence length 520
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
  Other interleukin signaling
Interleukin-20 family signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Psoriasis vulgaris Psoriasis vulgaris N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Stimulate 23078630
Arthritis Rheumatoid Associate 24286242
Carcinoma Non Small Cell Lung Associate 37146414
COVID 19 Stimulate 34723226
Dementia Associate 36421848
Infections Associate 36379255
Inflammation Associate 34723226
Influenza Human Associate 36379255
Lung Diseases Associate 28777004
Melanoma Associate 20103601