Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1635
Gene name	DCMP deaminase
Gene symbol	DCTD
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q35.1
Summary	The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses

126

Show/Hide all (126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002623	hsa-miR-124-3p	Microarray	15685193
MIRT002623	hsa-miR-124-3p	Microarray	18668037
MIRT002623	hsa-miR-124-3p	Microarray	15685193
MIRT025957	hsa-miR-7-5p	Sequencing	20371350
MIRT027308	hsa-miR-101-3p	Sequencing	20371350
MIRT030192	hsa-miR-26b-5p	Microarray	19088304
MIRT051915	hsa-let-7b-5p	CLASH	23622248
MIRT049262	hsa-miR-92a-3p	CLASH	23622248
MIRT036295	hsa-miR-1229-3p	CLASH	23622248
MIRT036043	hsa-miR-1301-3p	CLASH	23622248
MIRT927116	hsa-miR-3646	CLIP-seq
MIRT927117	hsa-miR-4760-5p	CLIP-seq
MIRT927118	hsa-miR-4776-3p	CLIP-seq
MIRT927119	hsa-miR-548c-3p	CLIP-seq
MIRT927120	hsa-miR-1304	CLIP-seq
MIRT927121	hsa-miR-2467-5p	CLIP-seq
MIRT927122	hsa-miR-3188	CLIP-seq
MIRT927123	hsa-miR-3975	CLIP-seq
MIRT927124	hsa-miR-4645-3p	CLIP-seq
MIRT927125	hsa-miR-4699-5p	CLIP-seq
MIRT927126	hsa-miR-485-5p	CLIP-seq
MIRT1974566	hsa-miR-193a-3p	CLIP-seq
MIRT1974567	hsa-miR-193b	CLIP-seq
MIRT1974568	hsa-miR-4794	CLIP-seq
MIRT1974569	hsa-miR-892b	CLIP-seq
MIRT1974570	hsa-miR-145	CLIP-seq
MIRT1974571	hsa-miR-22	CLIP-seq
MIRT1974572	hsa-miR-3607-5p	CLIP-seq
MIRT1974573	hsa-miR-3925-3p	CLIP-seq
MIRT1974574	hsa-miR-4323	CLIP-seq
MIRT1974575	hsa-miR-4501	CLIP-seq
MIRT1974576	hsa-miR-4768-5p	CLIP-seq
MIRT1974577	hsa-miR-4775	CLIP-seq
MIRT1974578	hsa-miR-590-3p	CLIP-seq
MIRT1974579	hsa-miR-766	CLIP-seq
MIRT1974566	hsa-miR-193a-3p	CLIP-seq
MIRT1974567	hsa-miR-193b	CLIP-seq
MIRT2210012	hsa-miR-3653	CLIP-seq
MIRT2210013	hsa-miR-4659a-5p	CLIP-seq
MIRT2210014	hsa-miR-4659b-5p	CLIP-seq
MIRT2210015	hsa-miR-4670-3p	CLIP-seq
MIRT927117	hsa-miR-4760-5p	CLIP-seq
MIRT927118	hsa-miR-4776-3p	CLIP-seq
MIRT1974569	hsa-miR-892b	CLIP-seq
MIRT927120	hsa-miR-1304	CLIP-seq
MIRT2386787	hsa-miR-4659a-3p	CLIP-seq
MIRT2386788	hsa-miR-4659b-3p	CLIP-seq
MIRT2386789	hsa-miR-4735-5p	CLIP-seq
MIRT1974577	hsa-miR-4775	CLIP-seq
MIRT1974578	hsa-miR-590-3p	CLIP-seq
MIRT927120	hsa-miR-1304	CLIP-seq
MIRT927121	hsa-miR-2467-5p	CLIP-seq
MIRT927122	hsa-miR-3188	CLIP-seq
MIRT927123	hsa-miR-3975	CLIP-seq
MIRT927124	hsa-miR-4645-3p	CLIP-seq
MIRT927125	hsa-miR-4699-5p	CLIP-seq
MIRT927126	hsa-miR-485-5p	CLIP-seq
MIRT2513900	hsa-miR-1207-5p	CLIP-seq
MIRT2513901	hsa-miR-1275	CLIP-seq
MIRT2513902	hsa-miR-185	CLIP-seq
MIRT2513903	hsa-miR-3622b-5p	CLIP-seq
MIRT2513904	hsa-miR-3914	CLIP-seq
MIRT2513905	hsa-miR-4253	CLIP-seq
MIRT2513906	hsa-miR-4260	CLIP-seq
MIRT2513907	hsa-miR-4279	CLIP-seq
MIRT2513908	hsa-miR-4306	CLIP-seq
MIRT2513909	hsa-miR-4428	CLIP-seq
MIRT2513910	hsa-miR-4438	CLIP-seq
MIRT2513911	hsa-miR-4488	CLIP-seq
MIRT2513912	hsa-miR-4528	CLIP-seq
MIRT2513913	hsa-miR-4644	CLIP-seq
MIRT2513914	hsa-miR-4665-5p	CLIP-seq
MIRT2513915	hsa-miR-4694-3p	CLIP-seq
MIRT2513916	hsa-miR-4697-5p	CLIP-seq
MIRT2513917	hsa-miR-4715-3p	CLIP-seq
MIRT2513918	hsa-miR-4761-3p	CLIP-seq
MIRT2513919	hsa-miR-4763-3p	CLIP-seq
MIRT2513920	hsa-miR-626	CLIP-seq
MIRT2513921	hsa-miR-7	CLIP-seq
MIRT927120	hsa-miR-1304	CLIP-seq
MIRT927120	hsa-miR-1304	CLIP-seq
MIRT2513900	hsa-miR-1207-5p	CLIP-seq
MIRT2513901	hsa-miR-1275	CLIP-seq
MIRT927120	hsa-miR-1304	CLIP-seq
MIRT2513902	hsa-miR-185	CLIP-seq
MIRT1974566	hsa-miR-193a-3p	CLIP-seq
MIRT1974567	hsa-miR-193b	CLIP-seq
MIRT927121	hsa-miR-2467-5p	CLIP-seq
MIRT927122	hsa-miR-3188	CLIP-seq
MIRT2513903	hsa-miR-3622b-5p	CLIP-seq
MIRT2210012	hsa-miR-3653	CLIP-seq
MIRT2679100	hsa-miR-3910	CLIP-seq
MIRT2513904	hsa-miR-3914	CLIP-seq
MIRT927123	hsa-miR-3975	CLIP-seq
MIRT2513905	hsa-miR-4253	CLIP-seq
MIRT2513906	hsa-miR-4260	CLIP-seq
MIRT2513907	hsa-miR-4279	CLIP-seq
MIRT2513908	hsa-miR-4306	CLIP-seq
MIRT2513909	hsa-miR-4428	CLIP-seq
MIRT2513910	hsa-miR-4438	CLIP-seq
MIRT2513911	hsa-miR-4488	CLIP-seq
MIRT2513912	hsa-miR-4528	CLIP-seq
MIRT2513913	hsa-miR-4644	CLIP-seq
MIRT927124	hsa-miR-4645-3p	CLIP-seq
MIRT2210013	hsa-miR-4659a-5p	CLIP-seq
MIRT2210014	hsa-miR-4659b-5p	CLIP-seq
MIRT2513914	hsa-miR-4665-5p	CLIP-seq
MIRT2210015	hsa-miR-4670-3p	CLIP-seq
MIRT2513915	hsa-miR-4694-3p	CLIP-seq
MIRT2513916	hsa-miR-4697-5p	CLIP-seq
MIRT927125	hsa-miR-4699-5p	CLIP-seq
MIRT2513917	hsa-miR-4715-3p	CLIP-seq
MIRT2679101	hsa-miR-4716-5p	CLIP-seq
MIRT927117	hsa-miR-4760-5p	CLIP-seq
MIRT2513918	hsa-miR-4761-3p	CLIP-seq
MIRT2513919	hsa-miR-4763-3p	CLIP-seq
MIRT2679102	hsa-miR-4766-3p	CLIP-seq
MIRT927118	hsa-miR-4776-3p	CLIP-seq
MIRT1974568	hsa-miR-4794	CLIP-seq
MIRT927126	hsa-miR-485-5p	CLIP-seq
MIRT2679103	hsa-miR-488	CLIP-seq
MIRT2679104	hsa-miR-548an	CLIP-seq
MIRT2513920	hsa-miR-626	CLIP-seq
MIRT2679105	hsa-miR-628-3p	CLIP-seq
MIRT2513921	hsa-miR-7	CLIP-seq
MIRT1974569	hsa-miR-892b	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004132	Function	DCMP deaminase activity	IBA
GO:0004132	Function	DCMP deaminase activity	IEA
GO:0004132	Function	DCMP deaminase activity	TAS	7685356
GO:0005515	Function	Protein binding	IPI	25416956, 29892012, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006220	Process	Pyrimidine nucleotide metabolic process	IEA
GO:0006220	Process	Pyrimidine nucleotide metabolic process	TAS	7685356
GO:0006226	Process	DUMP biosynthetic process	IBA
GO:0006231	Process	DTMP biosynthetic process	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009165	Process	Nucleotide biosynthetic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 21988832, 32296183
GO:0043174	Process	Nucleoside salvage	IMP	33833118
GO:0046872	Function	Metal ion binding	IEA
GO:0070694	Function	5-hydroxymethyl-dUMP N-hydrolase activity	IDA	33833118

MIM	HGNC	e!Ensembl
607638	2710	ENSG00000129187

P32321

Protein name

Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase)

Protein function

Catalyzes the deamination of dCMP to dUMP, providing the nucleoside monophosphate substrate for the thymidylate synthase/TYMS (PubMed:7685356). Also, part of a nucleotide salvage pathway that eliminates epigenetically modified 5-hydroxymethyl-dC

PDB

2W4L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00383	dCMP_cyt_deam_1	13 → 129	Cytidine and deoxycytidylate deaminase zinc-binding region	Family

Sequence

MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGC
SDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQA
GIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ

Sequence length

178

Interactions

View interactions

	KEGG		Reactome
	Pyrimidine metabolism Metabolic pathways Nucleotide metabolism		Interconversion of nucleotide di- and triphosphates

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRANULOMATOSIS WITH POLYANGIITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	12938148, 17602053	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	28912488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Associate	29141648	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	12819026, 20665488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	36952646	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Associate	17602053	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	20028759, 20665488	★★★★★ ★☆☆☆☆ Found in Text Mining only

DCTD (dCMP deaminase)