Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1634
Gene name	Decorin
Gene symbol	DCN
Synonyms (NCBI Gene)	CSCDDSPG2PG40PGIIPGS2SLRR1B
Chromosome	12
Chromosome location	12q21.33
Summary	This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature prot

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs80338741	A>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs80338742	G>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs397515545	C>-	Pathogenic	Frameshift variant, coding sequence variant, 3 prime UTR variant
rs587777258	T>-	Pathogenic	Coding sequence variant, frameshift variant, 3 prime UTR variant

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT926410	hsa-miR-4698	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT1974474	hsa-miR-4464	CLIP-seq
MIRT1974475	hsa-miR-4748	CLIP-seq
MIRT2428134	hsa-miR-105	CLIP-seq
MIRT2428135	hsa-miR-1202	CLIP-seq
MIRT2428136	hsa-miR-1207-5p	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT2428137	hsa-miR-1343	CLIP-seq
MIRT2428138	hsa-miR-145	CLIP-seq
MIRT2428139	hsa-miR-154	CLIP-seq
MIRT2428140	hsa-miR-181a	CLIP-seq
MIRT2428141	hsa-miR-181b	CLIP-seq
MIRT2428142	hsa-miR-181c	CLIP-seq
MIRT2428143	hsa-miR-181d	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT2428144	hsa-miR-224	CLIP-seq
MIRT2428145	hsa-miR-2467-5p	CLIP-seq
MIRT2428146	hsa-miR-299-3p	CLIP-seq
MIRT2428147	hsa-miR-3074-5p	CLIP-seq
MIRT2428148	hsa-miR-3145-5p	CLIP-seq
MIRT2428149	hsa-miR-3163	CLIP-seq
MIRT2428150	hsa-miR-3180-5p	CLIP-seq
MIRT2428151	hsa-miR-3188	CLIP-seq
MIRT2428152	hsa-miR-340	CLIP-seq
MIRT2428153	hsa-miR-3591-5p	CLIP-seq
MIRT2428154	hsa-miR-3606	CLIP-seq
MIRT2428155	hsa-miR-3607-5p	CLIP-seq
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT2428156	hsa-miR-3671	CLIP-seq
MIRT2428157	hsa-miR-3690	CLIP-seq
MIRT2428158	hsa-miR-371-5p	CLIP-seq
MIRT2428159	hsa-miR-371b-5p	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT2428160	hsa-miR-3972	CLIP-seq
MIRT2428161	hsa-miR-3975	CLIP-seq
MIRT2428162	hsa-miR-421	CLIP-seq
MIRT2428163	hsa-miR-4254	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT2428164	hsa-miR-4262	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT1974474	hsa-miR-4464	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT2428165	hsa-miR-4699-3p	CLIP-seq
MIRT2428166	hsa-miR-4709-5p	CLIP-seq
MIRT2428167	hsa-miR-4712-5p	CLIP-seq
MIRT2428168	hsa-miR-4736	CLIP-seq
MIRT2428169	hsa-miR-4742-5p	CLIP-seq
MIRT1974475	hsa-miR-4748	CLIP-seq
MIRT2428170	hsa-miR-4755-3p	CLIP-seq
MIRT2428171	hsa-miR-4763-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT2428172	hsa-miR-4776-3p	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT2428173	hsa-miR-485-5p	CLIP-seq
MIRT2428174	hsa-miR-508-5p	CLIP-seq
MIRT2428175	hsa-miR-513a-3p	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT2428176	hsa-miR-555	CLIP-seq
MIRT2428177	hsa-miR-556-5p	CLIP-seq
MIRT2428178	hsa-miR-590-3p	CLIP-seq
MIRT2428179	hsa-miR-607	CLIP-seq
MIRT2428180	hsa-miR-610	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT2428181	hsa-miR-770-5p	CLIP-seq
MIRT2428182	hsa-miR-875-3p	CLIP-seq
MIRT2428183	hsa-miR-921	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT2513724	hsa-let-7a	CLIP-seq
MIRT2513725	hsa-let-7b	CLIP-seq
MIRT2513726	hsa-let-7c	CLIP-seq
MIRT2513727	hsa-let-7d	CLIP-seq
MIRT2513728	hsa-let-7e	CLIP-seq
MIRT2513729	hsa-let-7f	CLIP-seq
MIRT2513730	hsa-let-7g	CLIP-seq
MIRT2513731	hsa-let-7i	CLIP-seq
MIRT2513732	hsa-miR-103b	CLIP-seq
MIRT2428134	hsa-miR-105	CLIP-seq
MIRT2428135	hsa-miR-1202	CLIP-seq
MIRT2428136	hsa-miR-1207-5p	CLIP-seq
MIRT2513733	hsa-miR-1251	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT2513734	hsa-miR-1321	CLIP-seq
MIRT2428137	hsa-miR-1343	CLIP-seq
MIRT2428139	hsa-miR-154	CLIP-seq
MIRT2428140	hsa-miR-181a	CLIP-seq
MIRT2428141	hsa-miR-181b	CLIP-seq
MIRT2428142	hsa-miR-181c	CLIP-seq
MIRT2428143	hsa-miR-181d	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT2513735	hsa-miR-2113	CLIP-seq
MIRT2513736	hsa-miR-2117	CLIP-seq
MIRT2513737	hsa-miR-218	CLIP-seq
MIRT2428145	hsa-miR-2467-5p	CLIP-seq
MIRT2428147	hsa-miR-3074-5p	CLIP-seq
MIRT2513738	hsa-miR-3143	CLIP-seq
MIRT2428148	hsa-miR-3145-5p	CLIP-seq
MIRT2513739	hsa-miR-3158-3p	CLIP-seq
MIRT2513740	hsa-miR-3160-5p	CLIP-seq
MIRT2513741	hsa-miR-3162-5p	CLIP-seq
MIRT2428149	hsa-miR-3163	CLIP-seq
MIRT2428151	hsa-miR-3188	CLIP-seq
MIRT2513742	hsa-miR-325	CLIP-seq
MIRT2428152	hsa-miR-340	CLIP-seq
MIRT2428153	hsa-miR-3591-5p	CLIP-seq
MIRT2428154	hsa-miR-3606	CLIP-seq
MIRT2513743	hsa-miR-3616-3p	CLIP-seq
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT2513744	hsa-miR-3662	CLIP-seq
MIRT2428156	hsa-miR-3671	CLIP-seq
MIRT2513745	hsa-miR-3675-3p	CLIP-seq
MIRT2428157	hsa-miR-3690	CLIP-seq
MIRT2428158	hsa-miR-371-5p	CLIP-seq
MIRT2428159	hsa-miR-371b-5p	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT2513746	hsa-miR-376c	CLIP-seq
MIRT2513747	hsa-miR-377	CLIP-seq
MIRT2513748	hsa-miR-3927	CLIP-seq
MIRT2428160	hsa-miR-3972	CLIP-seq
MIRT2428161	hsa-miR-3975	CLIP-seq
MIRT2428162	hsa-miR-421	CLIP-seq
MIRT2428163	hsa-miR-4254	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT2428164	hsa-miR-4262	CLIP-seq
MIRT2513749	hsa-miR-4277	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT2513750	hsa-miR-4305	CLIP-seq
MIRT2513751	hsa-miR-4432	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT2513752	hsa-miR-4458	CLIP-seq
MIRT2513753	hsa-miR-4500	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT2513754	hsa-miR-4650-3p	CLIP-seq
MIRT2513755	hsa-miR-4662a-3p	CLIP-seq
MIRT2513756	hsa-miR-4684-5p	CLIP-seq
MIRT2428165	hsa-miR-4699-3p	CLIP-seq
MIRT2428166	hsa-miR-4709-5p	CLIP-seq
MIRT2513757	hsa-miR-4721	CLIP-seq
MIRT2428168	hsa-miR-4736	CLIP-seq
MIRT2513758	hsa-miR-4739	CLIP-seq
MIRT2428169	hsa-miR-4742-5p	CLIP-seq
MIRT2428170	hsa-miR-4755-3p	CLIP-seq
MIRT2513759	hsa-miR-4756-5p	CLIP-seq
MIRT2428171	hsa-miR-4763-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT2428172	hsa-miR-4776-3p	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT2428173	hsa-miR-485-5p	CLIP-seq
MIRT2513760	hsa-miR-489	CLIP-seq
MIRT2513761	hsa-miR-494	CLIP-seq
MIRT2428174	hsa-miR-508-5p	CLIP-seq
MIRT2513762	hsa-miR-526b	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT2428177	hsa-miR-556-5p	CLIP-seq
MIRT2513763	hsa-miR-578	CLIP-seq
MIRT2513764	hsa-miR-580	CLIP-seq
MIRT2428178	hsa-miR-590-3p	CLIP-seq
MIRT2428179	hsa-miR-607	CLIP-seq
MIRT2428180	hsa-miR-610	CLIP-seq
MIRT2513765	hsa-miR-628-3p	CLIP-seq
MIRT2513766	hsa-miR-636	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT2513767	hsa-miR-767-3p	CLIP-seq
MIRT2513768	hsa-miR-873	CLIP-seq
MIRT2428182	hsa-miR-875-3p	CLIP-seq
MIRT2513769	hsa-miR-888	CLIP-seq
MIRT2428183	hsa-miR-921	CLIP-seq
MIRT2513770	hsa-miR-935	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT2513771	hsa-miR-98	CLIP-seq
MIRT2513724	hsa-let-7a	CLIP-seq
MIRT2513725	hsa-let-7b	CLIP-seq
MIRT2513726	hsa-let-7c	CLIP-seq
MIRT2513727	hsa-let-7d	CLIP-seq
MIRT2513728	hsa-let-7e	CLIP-seq
MIRT2513729	hsa-let-7f	CLIP-seq
MIRT2513730	hsa-let-7g	CLIP-seq
MIRT2513731	hsa-let-7i	CLIP-seq
MIRT2513732	hsa-miR-103b	CLIP-seq
MIRT2428134	hsa-miR-105	CLIP-seq
MIRT2428135	hsa-miR-1202	CLIP-seq
MIRT2428136	hsa-miR-1207-5p	CLIP-seq
MIRT2513733	hsa-miR-1251	CLIP-seq
MIRT1547869	hsa-miR-1256	CLIP-seq
MIRT1547870	hsa-miR-1271	CLIP-seq
MIRT2513734	hsa-miR-1321	CLIP-seq
MIRT2428137	hsa-miR-1343	CLIP-seq
MIRT2428138	hsa-miR-145	CLIP-seq
MIRT2428139	hsa-miR-154	CLIP-seq
MIRT2428140	hsa-miR-181a	CLIP-seq
MIRT2428141	hsa-miR-181b	CLIP-seq
MIRT2428142	hsa-miR-181c	CLIP-seq
MIRT2428143	hsa-miR-181d	CLIP-seq
MIRT1547871	hsa-miR-182	CLIP-seq
MIRT2513735	hsa-miR-2113	CLIP-seq
MIRT2513736	hsa-miR-2117	CLIP-seq
MIRT2513737	hsa-miR-218	CLIP-seq
MIRT2428144	hsa-miR-224	CLIP-seq
MIRT2428145	hsa-miR-2467-5p	CLIP-seq
MIRT2428146	hsa-miR-299-3p	CLIP-seq
MIRT2428147	hsa-miR-3074-5p	CLIP-seq
MIRT2679080	hsa-miR-3119	CLIP-seq
MIRT2513738	hsa-miR-3143	CLIP-seq
MIRT2428148	hsa-miR-3145-5p	CLIP-seq
MIRT2513739	hsa-miR-3158-3p	CLIP-seq
MIRT2513740	hsa-miR-3160-5p	CLIP-seq
MIRT2513741	hsa-miR-3162-5p	CLIP-seq
MIRT2428149	hsa-miR-3163	CLIP-seq
MIRT2428150	hsa-miR-3180-5p	CLIP-seq
MIRT2428151	hsa-miR-3188	CLIP-seq
MIRT2513742	hsa-miR-325	CLIP-seq
MIRT2428152	hsa-miR-340	CLIP-seq
MIRT2428153	hsa-miR-3591-5p	CLIP-seq
MIRT2428154	hsa-miR-3606	CLIP-seq
MIRT2428155	hsa-miR-3607-5p	CLIP-seq
MIRT2513743	hsa-miR-3616-3p	CLIP-seq
MIRT926407	hsa-miR-3647-3p	CLIP-seq
MIRT2513744	hsa-miR-3662	CLIP-seq
MIRT2428156	hsa-miR-3671	CLIP-seq
MIRT2513745	hsa-miR-3675-3p	CLIP-seq
MIRT2428157	hsa-miR-3690	CLIP-seq
MIRT2428158	hsa-miR-371-5p	CLIP-seq
MIRT2428159	hsa-miR-371b-5p	CLIP-seq
MIRT1547872	hsa-miR-374c	CLIP-seq
MIRT2513746	hsa-miR-376c	CLIP-seq
MIRT2513747	hsa-miR-377	CLIP-seq
MIRT2679081	hsa-miR-3908	CLIP-seq
MIRT2513748	hsa-miR-3927	CLIP-seq
MIRT2679082	hsa-miR-3942-5p	CLIP-seq
MIRT2428160	hsa-miR-3972	CLIP-seq
MIRT2428161	hsa-miR-3975	CLIP-seq
MIRT2428162	hsa-miR-421	CLIP-seq
MIRT2428163	hsa-miR-4254	CLIP-seq
MIRT1547873	hsa-miR-4255	CLIP-seq
MIRT2428164	hsa-miR-4262	CLIP-seq
MIRT2513749	hsa-miR-4277	CLIP-seq
MIRT926409	hsa-miR-4282	CLIP-seq
MIRT2679083	hsa-miR-4293	CLIP-seq
MIRT2513750	hsa-miR-4305	CLIP-seq
MIRT1547874	hsa-miR-4450	CLIP-seq
MIRT2679084	hsa-miR-4452	CLIP-seq
MIRT2513752	hsa-miR-4458	CLIP-seq
MIRT1974474	hsa-miR-4464	CLIP-seq
MIRT2513753	hsa-miR-4500	CLIP-seq
MIRT1547875	hsa-miR-4642	CLIP-seq
MIRT2513754	hsa-miR-4650-3p	CLIP-seq
MIRT2513755	hsa-miR-4662a-3p	CLIP-seq
MIRT2513756	hsa-miR-4684-5p	CLIP-seq
MIRT2428165	hsa-miR-4699-3p	CLIP-seq
MIRT2679085	hsa-miR-4703-5p	CLIP-seq
MIRT2428166	hsa-miR-4709-5p	CLIP-seq
MIRT2428167	hsa-miR-4712-5p	CLIP-seq
MIRT2513757	hsa-miR-4721	CLIP-seq
MIRT2428168	hsa-miR-4736	CLIP-seq
MIRT2513758	hsa-miR-4739	CLIP-seq
MIRT2679086	hsa-miR-4742-3p	CLIP-seq
MIRT2428169	hsa-miR-4742-5p	CLIP-seq
MIRT1974475	hsa-miR-4748	CLIP-seq
MIRT2428170	hsa-miR-4755-3p	CLIP-seq
MIRT2513759	hsa-miR-4756-5p	CLIP-seq
MIRT2428171	hsa-miR-4763-3p	CLIP-seq
MIRT2679087	hsa-miR-4766-3p	CLIP-seq
MIRT926408	hsa-miR-4766-5p	CLIP-seq
MIRT2428172	hsa-miR-4776-3p	CLIP-seq
MIRT1547876	hsa-miR-4797-5p	CLIP-seq
MIRT2428173	hsa-miR-485-5p	CLIP-seq
MIRT2513760	hsa-miR-489	CLIP-seq
MIRT2679088	hsa-miR-491-3p	CLIP-seq
MIRT2513761	hsa-miR-494	CLIP-seq
MIRT2428174	hsa-miR-508-5p	CLIP-seq
MIRT2513762	hsa-miR-526b	CLIP-seq
MIRT926411	hsa-miR-548c-3p	CLIP-seq
MIRT2679089	hsa-miR-548g	CLIP-seq
MIRT2428176	hsa-miR-555	CLIP-seq
MIRT2428177	hsa-miR-556-5p	CLIP-seq
MIRT2513763	hsa-miR-578	CLIP-seq
MIRT2513764	hsa-miR-580	CLIP-seq
MIRT2679090	hsa-miR-586	CLIP-seq
MIRT2428178	hsa-miR-590-3p	CLIP-seq
MIRT2679091	hsa-miR-596	CLIP-seq
MIRT2428179	hsa-miR-607	CLIP-seq
MIRT2428180	hsa-miR-610	CLIP-seq
MIRT2513765	hsa-miR-628-3p	CLIP-seq
MIRT2513766	hsa-miR-636	CLIP-seq
MIRT1547877	hsa-miR-655	CLIP-seq
MIRT2513767	hsa-miR-767-3p	CLIP-seq
MIRT2428181	hsa-miR-770-5p	CLIP-seq
MIRT2513768	hsa-miR-873	CLIP-seq
MIRT2428182	hsa-miR-875-3p	CLIP-seq
MIRT2513769	hsa-miR-888	CLIP-seq
MIRT2428183	hsa-miR-921	CLIP-seq
MIRT2513770	hsa-miR-935	CLIP-seq
MIRT1547878	hsa-miR-96	CLIP-seq
MIRT2513771	hsa-miR-98	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
JUN	Repression	8798756
NR1H4	Activation	18514055

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	1747115, 11598131, 20026052, 25331875, 25789606
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0009887	Process	Animal organ morphogenesis	TAS	7961765
GO:0010508	Process	Positive regulation of autophagy	IDA	23798385
GO:0010596	Process	Negative regulation of endothelial cell migration	IDA	23798385
GO:0016239	Process	Positive regulation of macroautophagy	IDA	23798385
GO:0016239	Process	Positive regulation of macroautophagy	IGI	23798385
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23978385
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	ISS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 25037231, 27559042, 28327460, 28675934
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28327460, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23798385
GO:0050840	Function	Extracellular matrix binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23798385
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IGI	23798385
GO:0090141	Process	Positive regulation of mitochondrial fission	IGI	23798385
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IDA	23798385

MIM	HGNC	e!Ensembl
125255	2705	ENSG00000011465

P07585

Protein name

Decorin (Bone proteoglycan II) (PG-S2) (PG40)

Protein function

May affect the rate of fibrils formation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01462	LRRNT	53 → 80	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	81 → 141	Leucine rich repeat	Repeat
PF13855	LRR_8	150 → 218	Leucine rich repeat	Repeat
PF13855	LRR_8	221 → 281	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Detected in cerebrospinal fluid, fibroblasts and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:

Sequence

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE
LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS
LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Sequence length

359

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway Cytoskeleton in muscle cells Proteoglycans in cancer		Degradation of the extracellular matrix A tetrasaccharide linker sequence is required for GAG synthesis Chondroitin sulfate biosynthesis Dermatan sulfate biosynthesis CS/DS degradation ECM proteoglycans Defective B4GALT7 causes EDS, progeroid type Defective B3GAT3 causes JDSSDHD Defective CHST3 causes SEDCJD Defective CHST14 causes EDS, musculocontractural type Defective CHSY1 causes TPBS Defective B3GALT6 causes EDSP2 and SEMDJL1

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital stromal corneal dystrophy	Pathogenic	rs587777258, rs80338741, rs80338742, rs397515545	RCV000114315 RCV000018366 RCV000020465 RCV000055876

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
DCN-related disorder	Likely benign; Benign	rs758251041, rs191218249, rs142752401	RCV003964220 RCV003957612 RCV003910151

Show/Hide Text Mining Associations (139)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achondrogenesis type 2	Associate	11570921
Adenocarcinoma of Lung	Inhibit	30604627, 30840274
Adenocarcinoma of Lung	Associate	32519739
Adenoma	Associate	30175151
Alopecia Areata	Associate	36809409
Astrocytoma	Associate	19320777
Ataxia Telangiectasia	Associate	30679601
Atherosclerosis	Associate	38256024
Brain Neoplasms	Inhibit	33878734
Breast Neoplasms	Associate	18293176, 19036156, 22363530, 23007289, 23350987, 24403067, 25400079, 32406376, 34055036
Breast Neoplasms	Inhibit	20398359, 28174297
CADASIL	Stimulate	25026535
CADASIL	Associate	25578324
Calcinosis	Associate	10934647, 21791066
Carcinogenesis	Associate	12927043, 18293176, 21360479, 22363530, 34358255, 35777025
Carcinoma Hepatocellular	Inhibit	11461082, 12521301, 29879025
Carcinoma Hepatocellular	Associate	24083576, 32311840, 33878734, 34238253, 38420809, 39350070, 40349011
Carcinoma in Situ	Stimulate	21791066
Carcinoma Non Small Cell Lung	Associate	25524578, 30840274
Carcinoma Ovarian Epithelial	Associate	21637745
Carcinoma Ovarian Epithelial	Inhibit	21637745
Carcinoma Renal Cell	Associate	34358255
Carcinoma Squamous Cell	Associate	21958730, 22507529
Carcinoma Squamous Cell	Inhibit	38188687
Cardiovascular Diseases	Associate	32174066
Cartilage Diseases	Associate	8689458
Cataract	Stimulate	32180680
Cell Transformation Neoplastic	Inhibit	32209654
Cerebral Small Vessel Diseases	Associate	25578324
Cholangiocarcinoma	Inhibit	24272200
Colonic Neoplasms	Stimulate	12385781, 1710888
Colonic Neoplasms	Associate	2162845, 8702560
Colorectal Neoplasms	Associate	1710888, 28567416, 7624361
Congenital disorder of glycosylation type 2A	Inhibit	7490271
Congenital Disorders of Glycosylation	Associate	7490271
Corneal Dystrophies Hereditary	Associate	22870031
Corneal Dystrophy Congenital Stromal	Associate	22870031, 26828927
Corneal Dystrophy Posterior Amorphous	Associate	24759697, 29671669
COVID 19	Associate	34506752
COVID 19	Inhibit	37964271
Cystitis Interstitial	Associate	18082196
De Barsy syndrome	Associate	26828927
Depressive Disorder Major	Inhibit	17660861
Diabetes Mellitus	Associate	10449443, 35119024
Diabetes Mellitus Type 1	Associate	10449443, 24204704
Diabetic Nephropathies	Associate	10652025
Disease	Inhibit	12112390
Ehlers Danlos Syndrome	Associate	25232019
Endometrial Neoplasms	Associate	10901378, 35832124
Endometriosis	Associate	25244916
Epidermal Nevus	Associate	21958730
Familial Primary Pulmonary Hypertension	Associate	16390543
Fetal Membranes Premature Rupture	Associate	25232019
Fibrosis	Associate	10652025, 11168935, 12112390, 35159124
Glaucoma Open Angle	Inhibit	19145252
Glioblastoma	Associate	26230845
Glomerulonephritis	Associate	11168935
Glomerulonephritis IGA	Associate	21494642
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12927043
Idiopathic Noncirrhotic Portal Hypertension	Associate	39350070
Idiopathic Pulmonary Fibrosis	Stimulate	34209854
Immunologic Deficiency Syndromes	Associate	1479602
Infections	Inhibit	25232019
Infertility	Associate	32041647
Inflammation	Associate	16394277, 24204704, 32174066, 34964698, 7744809
Inflammation	Inhibit	35391926
Intervertebral Disc Degeneration	Associate	35409356
Keratoconus	Associate	11683372
Kidney Diseases	Associate	11012890, 12112390, 32174066
Laryngeal Neoplasms	Associate	18383852
Leiomyoma	Associate	26423601
Leiomyosarcoma	Associate	34321013
Liver Cirrhosis	Associate	29879025, 35159124
Lung Diseases	Stimulate	34232735
Lung Neoplasms	Associate	21360479
Lymphatic Metastasis	Associate	21360479, 25524578
Lymphatic Metastasis	Stimulate	22363530
Macular Degeneration	Associate	35391926
Marfan Syndrome	Associate	1479602, 2211661
Melanoma	Associate	3949779
Mitral Valve Insufficiency	Associate	38523390
Mitral Valve Prolapse	Associate	27213335
Mitral Valve Prolapse Myxomatous 1	Stimulate	18621549
Mitral Valve Stenosis	Associate	27213335
Mixed Tumor Malignant	Associate	18413650
Mouth Neoplasms	Associate	21958730, 22507529
Multiple Myeloma	Inhibit	18436739
Multiple Sclerosis	Associate	20456365
Muscular Dystrophy Duchenne	Associate	16989735
Musculoskeletal Diseases	Associate	36981001
Myxoma	Associate	19320777
Neoplasm Invasiveness	Associate	32801084
Neoplasm Metastasis	Stimulate	25524578
Neoplasm Metastasis	Inhibit	30840274, 32306717, 35777025
Neoplasm Metastasis	Associate	34358255
Neoplasms	Associate	10901378, 12385781, 16908595, 18505923, 21840990, 22363530, 22507529, 23350987, 25524578, 26230845, 29605717, 30175151, 32209654, 34964698, 35409069, 35777025, 35833571, 37852187, 7744809 View all (4 more)
Neoplasms	Stimulate	18383852
Neoplasms	Inhibit	18413650, 19433454, 19678923, 24272200, 24403067, 24472739, 25244916, 26001829, 27025787, 29879025, 31727599, 32306717, 34379688, 40349011, 8702560
Neuroblastoma	Associate	26230845
Neurodegenerative Diseases	Associate	30679601
Non Muscle Invasive Bladder Neoplasms	Associate	32786144
Obesity	Associate	27699222
Osteoarthritis	Associate	11597178, 34208590, 35119024
Osteoarthropathy Primary Hypertrophic	Stimulate	8592084
Osteoporosis	Associate	35661288
Osteosarcoma	Associate	18505923, 20340016
Ovarian Neoplasms	Associate	35915456
Pancreatic Neoplasms	Stimulate	34021540
Pancreatitis	Associate	34964698
Pancreatitis Chronic	Associate	16394277
Parkinson Disease	Associate	35112150
Pelvic Organ Prolapse	Associate	29630675, 38488886
Phyllodes Tumor	Inhibit	25400079
Plaque Amyloid	Associate	10652025
Polycystic Ovary Syndrome	Stimulate	28789706
Pre Eclampsia	Associate	36852440
Premature Birth	Associate	25232019
Progeroid syndrome neonatal	Associate	8486665
Prostatic Neoplasms	Associate	14613585, 21804603, 31727599
Prostatic Neoplasms	Inhibit	32306717
Prostatitis	Associate	21804603
Pulmonary Disease Chronic Obstructive	Inhibit	16707515, 19087346, 27418555, 33656381
Pulmonary Disease Chronic Obstructive	Associate	16780585, 22241744, 23997174, 32460521
Renal Insufficiency Chronic	Associate	35705063
Sick Sinus Syndrome	Stimulate	22363530
Smooth Muscle Tumor	Associate	18245265
Squamous Cell Carcinoma of Head and Neck	Associate	32801084
Status Asthmaticus	Associate	18245265
Stomach Neoplasms	Associate	32314688, 34379688, 37290894
Stress Disorders Post Traumatic	Associate	38212778
Tendinopathy	Inhibit	14554207
Thrombosis	Associate	33878734
Thrombosis	Inhibit	38256024
Triple Negative Breast Neoplasms	Associate	37963845
Urethral Neoplasms	Associate	21840990
Urinary Bladder Neoplasms	Associate	21840990, 24146840, 28459201, 35777025
Uterine Cervical Neoplasms	Inhibit	35420507
Uterine Cervical Neoplasms	Associate	39372720
Uterine Diseases	Associate	25244916

DCN (decorin)