Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
163087
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 383
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF383
Synonyms (NCBI Gene) Gene synonyms aliases
HSD17, Zfp383
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a KRAB-related zinc finger protein that inhibits the transcription of some MAPK signaling pathway genes. The repressor activity resides in the KRAB domain of the encoded protein. [provided by RefSeq, Sep 2016]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042301 hsa-miR-484 CLASH 23622248
MIRT042301 hsa-miR-484 CLASH 23622248
MIRT693772 hsa-miR-4797-5p HITS-CLIP 23313552
MIRT693771 hsa-miR-508-5p HITS-CLIP 23313552
MIRT693770 hsa-miR-5586-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619499 18609 ENSG00000188283
Protein
UniProt ID Q8NA42
Protein name Zinc finger protein 383
Protein function May function as a transcriptional repressor, suppressing transcriptional activities mediated by MAPK signaling pathways.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 5 46 KRAB box Family
PF00096 zf-C2H2 170 192 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 226 248 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 254 276 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 282 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 360 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 388 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 394 416 Zinc finger, C2H2 type Domain
PF13465 zf-H2C2_2 436 461 Domain
PF00096 zf-C2H2 450 472 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, placenta, liver, pancreas and with a higher level in skeletal muscle. {ECO:0000269|PubMed:15964543}.
Sequence
MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYGNLVSMGLYTPKPQVISLLEQ
GKEPWMVGRELTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDV
LEYRSHLAKQLGYPNGHFSQEIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFS
QNSQFIQHQRIH
IGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSCSSY
LSQHQRIH
TGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYECKVCGKAFTKSSQLFQH
ARIH
TGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIH
TGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEK
PYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNK
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
<