ZNF846 (zinc finger protein 846)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 162993
Gene name Zinc finger protein 846
Gene symbol ZNF846
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.2
miRNA miRNA information provided by mirtarbase database.
52
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (52)
miRTarBase ID miRNA Experiments Reference
MIRT571504 hsa-miR-199a-5p PAR-CLIP 20371350
MIRT571503 hsa-miR-199b-5p PAR-CLIP 20371350
MIRT571502 hsa-miR-889-5p PAR-CLIP 20371350
MIRT571501 hsa-miR-135a-5p PAR-CLIP 20371350
MIRT571500 hsa-miR-135b-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q147U1
Protein name Zinc finger protein 846
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 7 → 47 KRAB box Family
PF00096 zf-C2H2 198 → 220 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 226 → 248 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 254 → 276 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 282 → 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 → 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 → 360 Zinc finger, C2H2 type Domain
PF13465 zf-H2C2_2 380 → 405 Domain
PF00096 zf-C2H2 422 → 444 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 450 → 472 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 478 → 500 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 506 → 527 Zinc finger, C2H2 type Domain
Sequence 
MDSSQHLVTFEDVAVDFTQEEWTLLDQAQRDLYRDVMLENYKNLIILAGSELFKRSLMSG
LEQMEELRTGVTGVLQELDLQLKTKGSPLLQDISAERSPNGVQLERSNTAEKLYDSNHSG
KVFNEHPFLMTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAFN
QFPNLTRQNKTHTQEKLCECKDCWRTFLNQSSLKLHIRSHNGDKHYVCKECGKAFSNSSH
LIGHGRIHSGEKPYVCKECGKAFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDH
TRIHSGKKPYVCMECGKAFTRSTGLILHMRIHTGEKPYECKECGKAFIHSSYLTKHVRIH
SGEKLYLCKACGKAFTRSSGLVLHMRTHTGEKPYECKECGKAFNNSSMLSQHVRIHTGEK
PYECKECGKAFTQSSGLSTHLRTHTGEKACECKECGKAFARSTNLNMHMRTHTGEKPYAC
KECGKAFRYSTYLNVHTRTHTGAKPYECKKCGKNFTQSSALAKHLRTKACEKT
Sequence length 533
Interactions View interactions