DBP (D-box binding PAR bZIP transcription factor)

Gene

• Entrez ID: 1628
• Gene name: D-box binding PAR bZIP transcription factor
• Gene symbol: DBP
• Synonyms (NCBI Gene): DABP, taxREB302
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The protein encoded by this gene is a member of the PAR bZIP transcription factor family and binds to specific sequences in the promoters of several genes, such as albumin, CYP2A4, and CYP2A5. The encoded protein can bind DNA as a homo- or heterodimer and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT924102	hsa-miR-1207-3p	CLIP-seq
MIRT924103	hsa-miR-299-3p	CLIP-seq
MIRT924104	hsa-miR-3151	CLIP-seq
MIRT924105	hsa-miR-3202	CLIP-seq
MIRT924106	hsa-miR-4292	CLIP-seq
MIRT924107	hsa-miR-4308	CLIP-seq
MIRT924108	hsa-miR-4436b-3p	CLIP-seq
MIRT924109	hsa-miR-4447	CLIP-seq
MIRT924110	hsa-miR-4450	CLIP-seq
MIRT924111	hsa-miR-4472	CLIP-seq
MIRT924112	hsa-miR-4476	CLIP-seq
MIRT924113	hsa-miR-4640-5p	CLIP-seq
MIRT924114	hsa-miR-4726-5p	CLIP-seq
MIRT924115	hsa-miR-4743	CLIP-seq
MIRT924116	hsa-miR-4764-5p	CLIP-seq
MIRT924117	hsa-miR-486-3p	CLIP-seq
MIRT924118	hsa-miR-491-5p	CLIP-seq
MIRT924119	hsa-miR-585	CLIP-seq
MIRT2209216	hsa-miR-4686	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HLF	Activation	9571207
TEF	Unknown	8617210

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	20093779
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	20093779
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001889	Process	Liver development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	21988832, 23661758
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8786133
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20093779
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 124097
• HGNC: 2697
• e!Ensembl: ENSG00000105516

Protein

• UniProt ID: Q10586
• Protein name: D site-binding protein (Albumin D box-binding protein) (Albumin D-element-binding protein) (Tax-responsive enhancer element-binding protein 302) (TaxREB302)
• Protein function: This transcriptional activator recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. It is not essential for circadian rhythm generation, but modulates important clock output gen
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07716	bZIP_2	254 → 307	Basic region leucine zipper	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in the suprachiasmatic nuclei (SCN) and in most peripheral tissues, with a strong circadian rhythmicity.
• Sequence:

  MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPA
  ATTPGPGLETAGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLD
  AFLLEHGLPPSPPPPGGPSPEPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASG
  HRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPI
  MKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE
  VVAVRQELSHYRAVLSRYQAQHGAL

• Sequence length: 325

Pathways

KEGG:

Circadian rhythm