SLC16A11 (solute carrier family 16 member 11)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
162515
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 16 member 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC16A11
Synonyms (NCBI Gene) Gene synonyms aliases
MCT 11, MCT11
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.1
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28666119
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IDA 24390345
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005886 Component Plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
615765 23093 ENSG00000174326
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8NCK7
Protein name Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11)
Protein function Proton-linked monocarboxylate transporter. It catalyzes the transport of pyruvate across the plasma membrane (PubMed:28666119). Probably involved in hepatic lipid metabolism: overexpression results in an increase of triacylglycerol(TAG) levels,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07690 MFS_1 41 → 321 Major Facilitator Superfamily Family
Tissue specificity TISSUE SPECIFICITY: Expressed in liver, salivary gland and thyroid. {ECO:0000269|PubMed:24390345}.
Sequence 
MPAPQRKHRRGGFSHRCFPTPQTAMTPQPAGPPDGGWGWVVAAAAFAINGLSYGLLRSLG
LAFPDLAEHFDRSAQDTAWISALALAVQQAASPVGSALSTRWGARPVVMVGGVLASLGFV
FSAFASDLLHLYLGLGLLAGFGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSLLL
APALQLLLDTFGWRGALLLLGAITLHLTPCGALLLPLVLPGDPPAPPRSPLAALGLSLFT
RRAFSIFALGTALVGGGYFVPYVHLAPHALDRGLGGYGAALVVAVAAMGDAGARLVCGWL
ADQGWVPLPRLLAVFGALTGLGLWVVGLVPVVGGEESWGGPLLAAAVAYGLSAGSYAPLV
FGVLPGLVGVGGVVQATGLVMMLMSLGGLLGPPLSGFLRDETGDFTASFLLSGSLILSGS
FIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC
Sequence length 471
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes with ketoacidosis (PheCode 250.21), Type 2 diabetes, Childhood onset type 2 diabetes N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Show/Hide Text Mining Associations (6)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 37077914
Diabetes Mellitus Associate 26487785, 30696834, 32699108, 33479058
Diabetes Mellitus Type 1 Associate 38530923
Diabetes Mellitus Type 2 Associate 25973943, 26487785, 27175665, 28666119, 30696834, 33479058, 33909378, 38530923
Obesity Associate 26487785, 32699108, 33909378
Ovarian Neoplasms Associate 23571109