RETREG3 (reticulophagy regulator family member 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 162427
Gene name Reticulophagy regulator family member 3
Gene symbol RETREG3
Synonyms (NCBI Gene)
FAM134C
Chromosome 17
Chromosome location 17q21.2
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT477129 hsa-miR-6507-5p PAR-CLIP 23592263
MIRT477127 hsa-miR-6815-5p PAR-CLIP 23592263
MIRT477128 hsa-miR-6865-5p PAR-CLIP 23592263
MIRT477126 hsa-miR-548ao-5p PAR-CLIP 23592263
MIRT477125 hsa-miR-548ax PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 26040720, 29892012, 32296183, 32353859, 32814053, 33060197, 33826365, 33961781, 36217030
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0006914 Process Autophagy IEA
GO:0007029 Process Endoplasmic reticulum organization IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
616498 27258 ENSG00000141699
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86VR2
Protein name Reticulophagy regulator 3
Protein function Endoplasmic reticulum (ER)-anchored autophagy regulator which exists in an inactive state under basal conditions but is activated following cellular stress (PubMed:34338405). When activated, induces ER fragmentation and mediates ER delivery into
Family and domains
Sequence 
MAEAEGVPTTPGPASGSTFRGRRDVSGSWERDQQVEAAQRALVEVLGPYEPLLSRVQAAL
VWERPARSALWCLGLNAAFWFFALTSLRLVFLLAFGLMIIVCIDQWKNKIWPEIKVPRPD
ALDNESWGFVHPRLLSVPELCHHVAEVWVSGTIFIRNVLLFKKQNPGKFCLLSCGILTFL
AVLGRYVPGLLLSYLMLVTVMMWPLAVYHRLWDRAYVRLKPALQRLDFSVRGYMMSKQRE
RQLRRRALHPERAMDNHSDSEEELAAFCPQLDDSTVARELAITDSEHSDAEVSCTDNGTF
NLSRGQTPLTEGSEDLDGHSDPEESFARDLPDFPSINMDPAGLDDEDDTSIGMPSLMYRS
PPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSG
APAQRATRGFLRSPSSDLDTDAEGDDFELLDQSELSQLDPASSRSH
Sequence length 466
Interactions View interactions