Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
162417
Gene name Gene Name - the full gene name approved by the HGNC.
N-acetylglutamate synthase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NAGS
Synonyms (NCBI Gene) Gene synonyms aliases
AGAS, ARGA
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.
The N-acetylglutamate synthase gene encodes a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycl
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894604 G>A Pathogenic Stop gained, coding sequence variant
rs104894605 T>C Pathogenic Intron variant, missense variant, coding sequence variant
rs104894606 T>C,G Pathogenic Intron variant, missense variant, coding sequence variant
rs104894607 G>A,C Pathogenic Synonymous variant, intron variant, missense variant, coding sequence variant
rs202041339 T>C Likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT626560 hsa-miR-548c-3p HITS-CLIP 23824327
MIRT626559 hsa-miR-532-3p HITS-CLIP 23824327
MIRT626558 hsa-miR-7106-3p HITS-CLIP 23824327
MIRT626557 hsa-miR-6772-3p HITS-CLIP 23824327
MIRT626560 hsa-miR-548c-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000050 Process Urea cycle IEA
GO:0000050 Process Urea cycle TAS
GO:0004042 Function L-glutamate N-acetyltransferase activity EXP 12459178, 15050968
GO:0004042 Function L-glutamate N-acetyltransferase activity IBA
GO:0004042 Function L-glutamate N-acetyltransferase activity IDA 7126172, 23894642
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608300 17996 ENSG00000161653
Protein
UniProt ID Q8N159
Protein name N-acetylglutamate synthase, mitochondrial (EC 2.3.1.1) (Amino-acid acetyltransferase) [Cleaved into: N-acetylglutamate synthase long form; N-acetylglutamate synthase short form; N-acetylglutamate synthase conserved domain form]
Protein function Plays a role in the regulation of ureagenesis by producing the essential cofactor N-acetylglutamate (NAG), thus modulating carbamoylphosphate synthase I (CPS1) activity. {ECO:0000269|PubMed:12459178, ECO:0000269|PubMed:23894642, ECO:0000269|PubM
PDB 4K30
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04768 NAT 356 521 NAT, N-acetyltransferase, of N-acetylglutamate synthase Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the adult liver, kidney and small intestine. Weakly expressed in the fetal liver, lung, pancreas, placenta, heart and brain tissue. {ECO:0000269|PubMed:12459178, ECO:0000269|PubMed:12754705}.
Sequence
MATALMAVVLRAAAVAPRLRGRGGTGGARRLSCGARRRAARGTSPGRRLSTAWSQPQPPP
EEYAGADDVSQSPVAEEPSWVPSPRPPVPHESPEPPSGRSLVQRDIQAFLNQCGASPGEA
RHWLTQFQTCHHSADKPFAVIEVDEEVLKCQQGVSSLAFALAFLQRMDMKPLVVLGLPAP
TAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVS
VETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLR
DSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTE
LFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYV
SEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNP
INPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGL
PDSFHKPASDPGS
Sequence length 534
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Arginine biosynthesis
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
  Urea cycle
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hyperammonemia hyperammonemia, type iii rs755257734, rs730880266, rs1567941557, rs104894604, rs1597866317, rs730880267, rs1282296585, rs730880303, rs1597866458, rs121912591, rs2049059647, rs104894605, rs104894606, rs104894607, rs886042831
View all (1 more)
N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37047726
Diabetic Foot Associate 38287255
Glioblastoma Associate 37047726
Glioma Associate 37047726
Hyperammonemia Associate 21681857, 30337552
Liver Diseases Associate 39868884
Lung Neoplasms Associate 37047726
N acetyl glutamate synthetase deficiency Inhibit 15878741, 34510628
N acetyl glutamate synthetase deficiency Associate 15878741, 30337552, 34510628
Neoplasms Associate 37047726