Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	161882
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein, FOG family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZFPM1
Synonyms (NCBI Gene) Gene synonyms aliases	FOG, FOG1, ZC2HC11A, ZNF408, ZNF89A
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q24.2

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437880	hsa-miR-183-5p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437880	hsa-miR-183-5p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437881	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437881	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT694631	hsa-miR-3130-5p	HITS-CLIP	23313552
MIRT694630	hsa-miR-4482-5p	HITS-CLIP	23313552
MIRT694629	hsa-miR-29a-3p	HITS-CLIP	23313552
MIRT694628	hsa-miR-29b-3p	HITS-CLIP	23313552
MIRT694627	hsa-miR-29c-3p	HITS-CLIP	23313552
MIRT694626	hsa-miR-6871-3p	HITS-CLIP	23313552
MIRT694625	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT694624	hsa-miR-423-3p	HITS-CLIP	23313552
MIRT694623	hsa-miR-601	HITS-CLIP	23313552
MIRT694622	hsa-miR-4764-3p	HITS-CLIP	23313552
MIRT694621	hsa-miR-585-5p	HITS-CLIP	23313552
MIRT694620	hsa-miR-5682	HITS-CLIP	23313552
MIRT439236	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT439236	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT694631	hsa-miR-3130-5p	HITS-CLIP	23313552
MIRT694630	hsa-miR-4482-5p	HITS-CLIP	23313552
MIRT694629	hsa-miR-29a-3p	HITS-CLIP	23313552
MIRT694628	hsa-miR-29b-3p	HITS-CLIP	23313552
MIRT694627	hsa-miR-29c-3p	HITS-CLIP	23313552
MIRT694626	hsa-miR-6871-3p	HITS-CLIP	23313552
MIRT694625	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT694624	hsa-miR-423-3p	HITS-CLIP	23313552
MIRT694623	hsa-miR-601	HITS-CLIP	23313552
MIRT694622	hsa-miR-4764-3p	HITS-CLIP	23313552
MIRT694621	hsa-miR-585-5p	HITS-CLIP	23313552
MIRT694620	hsa-miR-5682	HITS-CLIP	23313552
MIRT2154136	hsa-miR-1470	CLIP-seq
MIRT2154137	hsa-miR-1913	CLIP-seq
MIRT2154138	hsa-miR-324-3p	CLIP-seq
MIRT2154139	hsa-miR-3937	CLIP-seq
MIRT2154140	hsa-miR-4313	CLIP-seq
MIRT2154141	hsa-miR-4645-5p	CLIP-seq
MIRT2154142	hsa-miR-4673	CLIP-seq
MIRT2154143	hsa-miR-4767	CLIP-seq

Show/Hide all(67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	15920471
GO:0000785	Component	Chromatin	ISA
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0002295	Process	T-helper cell lineage commitment	IC	21646796
GO:0002376	Process	Immune system process	IEA
GO:0002521	Process	Leukocyte differentiation	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003181	Process	Atrioventricular valve morphogenesis	IEA
GO:0003181	Process	Atrioventricular valve morphogenesis	ISS
GO:0003192	Process	Mitral valve formation	IEA
GO:0003192	Process	Mitral valve formation	ISS
GO:0003195	Process	Tricuspid valve formation	IEA
GO:0003195	Process	Tricuspid valve formation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	IGI	15920471
GO:0005515	Function	Protein binding	IPI	12483298, 19513100, 21047798, 21988832, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	15920471
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010724	Process	Regulation of definitive erythrocyte differentiation	IDA	15920471
GO:0010724	Process	Regulation of definitive erythrocyte differentiation	IMP	17207461
GO:0017053	Component	Transcription repressor complex	IDA	15920471
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IBA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030219	Process	Megakaryocyte differentiation	IBA
GO:0030219	Process	Megakaryocyte differentiation	IEA
GO:0030219	Process	Megakaryocyte differentiation	ISS
GO:0030220	Process	Platelet formation	IGI	11675338
GO:0030851	Process	Granulocyte differentiation	IEA
GO:0032642	Process	Regulation of chemokine production	IEA
GO:0032713	Process	Negative regulation of interleukin-4 production	IDA	21646796
GO:0032729	Process	Positive regulation of type II interferon production	IDA	21646796
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0035855	Process	Megakaryocyte development	IEA
GO:0045637	Process	Regulation of myeloid cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0055008	Process	Cardiac muscle tissue morphogenesis	IEA
GO:0055008	Process	Cardiac muscle tissue morphogenesis	ISS
GO:0060318	Process	Definitive erythrocyte differentiation	IEA
GO:0060319	Process	Primitive erythrocyte differentiation	IEA
GO:0060377	Process	Negative regulation of mast cell differentiation	IEA
GO:0060377	Process	Negative regulation of mast cell differentiation	ISS
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060413	Process	Atrial septum morphogenesis	IEA
GO:0060413	Process	Atrial septum morphogenesis	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	11675338, 12483298, 15920471

MIM	HGNC	e!Ensembl
601950	19762	ENSG00000179588

Protein

UniProt ID

Q8IX07

Protein name

Zinc finger protein ZFPM1 (Friend of GATA protein 1) (FOG-1) (Friend of GATA 1) (Zinc finger protein 89A) (Zinc finger protein multitype 1)

Protein function

Transcription regulator that plays an essential role in erythroid and megakaryocytic cell differentiation. Essential cofactor that acts via the formation of a heterodimer with transcription factors of the GATA family GATA1, GATA2 and GATA3. Such

PDB

2XU7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	291 → 314	Zinc finger, C2H2 type	Domain
PF12874	zf-met	974 → 994		Domain

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in hematopoietic tissues. Also expressed in adult cerebellum, stomach, lymph node, liver and pancreas. Expressed in fetal heart, liver and spleen. {ECO:0000269|PubMed:12483298}.

Sequence

MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPT
SPGGPKELEGQEPEPRPTEEEPGSPWSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHG
SVQTRASSPRQAEPSPALTLLLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPV
PAGGLLSVLLTAEPHSTPGHPVKKEPAEPTCPAPAHDLQLLPQQAGMASILATAVINKDV
FPCKDCGIWYRSERNLQAHLLYYCASRQGTGSPAAAATDEKPKETYPNERVCPFPQCRKS
CPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHSCGFISTTR
DILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGL
APTPSPGLDRKALAEATNGEARAEPLAQNGGSSEPPAAPRSIKVEAVEEPEAAPILGPGE
PGPQAPSRTPSPRSPAPARVKAELSSPTPGSSPVPGELGLAGALFLPQYVFGPDAAPPAS
EILAKMSELVHSRLQQGAGAGAGGAQTGLFPGAPKGATCFECEITFSNVNNYYVHKRLYC
SGRRAPEDAPAARRPKAPPGPARAPPGQPAEPDAPRSSPGPGAREEGAGGAATPEDGAGG
RGSEGSQSPGSSVDDAEDDPSRTLCEACNIRFSRHETYTVHKRYYCASRHDPPPRRPAAP
PGPPGPAAPPAPSPAAPVRTRRRRKLYELHAAGAPPPPPPGHAPAPESPRPGSGSGSGPG
LAPARSPGPAADGPIDLSKKPRRPLPGAPAPALADYHECTACRVSFHSLEAYLAHKKYSC
PAAPPPGALGLPAAACPYCPPNGPVRGDLLEHFRLAHGLLLGAPLAGPGVEARTPADRGP
SPAPAPAASPQPGSRGPRDGLGPEPQEPPPGPPPSPAAAPEAVPPPPAPPSYSDKGVQTP
SKGTPAPLPNGNHRYCRLCNIKFSSLSTFIAHKKYYCSSHAAEHVK

Sequence length

1006

Interactions

View interactions

	Reactome
			RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function Factors involved in megakaryocyte development and platelet production

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Carcinoma	Basal cell carcinoma	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Testicular Germ Cell Tumor	Testicular germ cell tumor	N/A	N/A	GWAS
Urolithiasis	Urolithiasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adrenocortical Carcinoma	Associate	30347759
Alzheimer Disease	Associate	31065058, 35347084
Anemia Hemolytic	Associate	19687298
Asthma	Associate	29692868
Fatigue	Stimulate	35672669
Heart Defects Congenital	Associate	28422132
Heredodegenerative Disorders Nervous System	Associate	35347084
Ige Responsiveness Atopic	Associate	26292806
KBG syndrome	Associate	28422132
Lewy Body Disease	Associate	31065058
Neoplasms	Associate	30347759
Neoplasms Germ Cell and Embryonal	Associate	26503584
Parkinson Disease	Associate	35672669
Psychotic Disorders	Associate	31065058
Tetralogy of Fallot	Associate	30582441

ZFPM1 (zinc finger protein, FOG family member 1)