Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1613
Gene name	Death associated protein kinase 3
Gene symbol	DAPK3
Synonyms (NCBI Gene)	DLKZIPZIPK
Chromosome	19
Chromosome location	19p13.3
Summary	Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. [provided by RefSeq, Jul 2008]

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051054	hsa-miR-17-5p	CLASH	23622248
MIRT048888	hsa-miR-93-5p	CLASH	23622248
MIRT051054	hsa-miR-17-5p	GFP reporter assayqRT-PCRWestern blot	26117336
MIRT1973524	hsa-miR-1224-3p	CLIP-seq
MIRT1973525	hsa-miR-1247	CLIP-seq
MIRT1973526	hsa-miR-1260	CLIP-seq
MIRT1973527	hsa-miR-1260b	CLIP-seq
MIRT1973528	hsa-miR-1280	CLIP-seq
MIRT1973529	hsa-miR-1288	CLIP-seq
MIRT1973530	hsa-miR-1343	CLIP-seq
MIRT1973531	hsa-miR-1909	CLIP-seq
MIRT1973532	hsa-miR-2861	CLIP-seq
MIRT1973533	hsa-miR-3191	CLIP-seq
MIRT1973534	hsa-miR-3197	CLIP-seq
MIRT1973535	hsa-miR-3199	CLIP-seq
MIRT1973536	hsa-miR-3667-5p	CLIP-seq
MIRT1973537	hsa-miR-378g	CLIP-seq
MIRT1973538	hsa-miR-3940-3p	CLIP-seq
MIRT1973539	hsa-miR-4493	CLIP-seq
MIRT1973540	hsa-miR-4652-5p	CLIP-seq
MIRT1973541	hsa-miR-493	CLIP-seq
MIRT1973542	hsa-miR-662	CLIP-seq
MIRT2209110	hsa-miR-128	CLIP-seq
MIRT2209111	hsa-miR-3154	CLIP-seq
MIRT2209112	hsa-miR-3190	CLIP-seq
MIRT1973536	hsa-miR-3667-5p	CLIP-seq
MIRT1973538	hsa-miR-3940-3p	CLIP-seq
MIRT2209113	hsa-miR-7	CLIP-seq

Show/Hide all (70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000775	Component	Chromosome, centromeric region	IDA	38009294
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0004672	Function	Protein kinase activity	IDA	38009294
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10356987, 18239682
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	16756490
GO:0005515	Function	Protein binding	IPI	15292222, 15910542, 17126281, 21454679, 21988832, 32707033, 33961781, 35271311, 38009294
GO:0005524	Function	ATP binding	IDA	10356987
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	9488481
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IDA	38009294
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10356987
GO:0006915	Process	Apoptotic process	IDA	10580117
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	12917339
GO:0006940	Process	Regulation of smooth muscle contraction	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	TAS
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	21487036
GO:0008140	Function	CAMP response element binding protein binding	TAS	14685163
GO:0008360	Process	Regulation of cell shape	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	TAS	16756490
GO:0016301	Function	Kinase activity	IEA
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IDA	18995835
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030496	Component	Midbody	IDA	38009294
GO:0030496	Component	Midbody	IEA
GO:0031267	Function	Small GTPase binding	IDA	23454120
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	23454120
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10356987
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042802	Function	Identical protein binding	IPI	18239682, 21487036
GO:0042803	Function	Protein homodimerization activity	IDA	18239682
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	16756490
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21487036
GO:0043519	Process	Regulation of myosin II filament organization	IEA
GO:0043522	Function	Leucine zipper domain binding	IPI	10580117
GO:0046777	Process	Protein autophosphorylation	IDA	18239682
GO:0046777	Process	Protein autophosphorylation	TAS	16756490
GO:0051893	Process	Regulation of focal adhesion assembly	IDA	23454120
GO:0071346	Process	Cellular response to type II interferon	IDA	18995835
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	21454679
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000145	Process	Regulation of cell motility	TAS

MIM	HGNC	e!Ensembl
603289	2676	ENSG00000167657

O43293

Protein name

Death-associated protein kinase 3 (DAP kinase 3) (EC 2.7.11.1) (DAP-like kinase) (Dlk) (MYPT1 kinase) (Zipper-interacting protein kinase) (ZIP-kinase)

Protein function

Serine/threonine kinase which is involved in the regulation of apoptosis, autophagy, transcription, translation and actin cytoskeleton reorganization. Involved in the regulation of smooth muscle contraction. Regulates both type I (caspase-depend

PDB

1YRP , 2J90 , 3BHY , 3BQR , 5A6N , 5A6O , 5VJA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	13 → 275	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Isoform 1 and isoform 2 are expressed in the bladder smooth muscle. {ECO:0000269|PubMed:15292222, ECO:0000269|PubMed:17126281}.

Sequence

MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR

Sequence length

454

Interactions

View interactions

	KEGG
	Autophagy - animal Pathways in cancer Bladder cancer

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Malignant tumor of esophagus	Uncertain significance	rs149596948	RCV005928966

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	22362584
Carcinoma Non Small Cell Lung	Associate	21487036
Carcinoma Renal Cell	Associate	35368029
Colitis	Associate	35604388
Colitis Associated Neoplasms	Associate	35604388
Colitis Ulcerative	Associate	35604388
Coronary Artery Disease	Associate	26305337
Ganglioneuroma	Stimulate	15605081
Graft vs Host Disease	Associate	20124481
Kidney Neoplasms	Associate	35368029
Leukemia Lymphocytic Chronic B Cell	Associate	20124481, 21526495
Leukemia Prolymphocytic T Cell	Associate	32306542
Lung Neoplasms	Associate	21775533
Medulloblastoma	Associate	11742505
Mitochondrial Diseases	Associate	11742505
Myelodysplastic Syndromes	Stimulate	11435312
Neoplasm Metastasis	Associate	11742505
Neoplasms	Inhibit	11742505, 21487036
Neoplasms	Associate	15140235, 20124481, 21487036
Neuroblastoma	Associate	15605081
Preeclamptic toxemia	Associate	29157033
Retinal Dysplasia	Associate	35604388
Stomach Neoplasms	Associate	34375503
Waardenburg syndrome type 2	Associate	8659547
Waardenburg syndrome type 2A	Associate	8659547

DAPK3 (death associated protein kinase 3)