Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1613
Gene name Gene Name - the full gene name approved by the HGNC.	Death associated protein kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DAPK3
Synonyms (NCBI Gene) Gene synonyms aliases	DLK, ZIP, ZIPK
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. [provided by RefSeq, Jul 2008]

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051054	hsa-miR-17-5p	CLASH	23622248
MIRT048888	hsa-miR-93-5p	CLASH	23622248
MIRT051054	hsa-miR-17-5p	GFP reporter assay, qRT-PCR, Western blot	26117336
MIRT1973524	hsa-miR-1224-3p	CLIP-seq
MIRT1973525	hsa-miR-1247	CLIP-seq
MIRT1973526	hsa-miR-1260	CLIP-seq
MIRT1973527	hsa-miR-1260b	CLIP-seq
MIRT1973528	hsa-miR-1280	CLIP-seq
MIRT1973529	hsa-miR-1288	CLIP-seq
MIRT1973530	hsa-miR-1343	CLIP-seq
MIRT1973531	hsa-miR-1909	CLIP-seq
MIRT1973532	hsa-miR-2861	CLIP-seq
MIRT1973533	hsa-miR-3191	CLIP-seq
MIRT1973534	hsa-miR-3197	CLIP-seq
MIRT1973535	hsa-miR-3199	CLIP-seq
MIRT1973536	hsa-miR-3667-5p	CLIP-seq
MIRT1973537	hsa-miR-378g	CLIP-seq
MIRT1973538	hsa-miR-3940-3p	CLIP-seq
MIRT1973539	hsa-miR-4493	CLIP-seq
MIRT1973540	hsa-miR-4652-5p	CLIP-seq
MIRT1973541	hsa-miR-493	CLIP-seq
MIRT1973542	hsa-miR-662	CLIP-seq
MIRT2209110	hsa-miR-128	CLIP-seq
MIRT2209111	hsa-miR-3154	CLIP-seq
MIRT2209112	hsa-miR-3190	CLIP-seq
MIRT1973536	hsa-miR-3667-5p	CLIP-seq
MIRT1973538	hsa-miR-3940-3p	CLIP-seq
MIRT2209113	hsa-miR-7	CLIP-seq

Show/Hide all(70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000775	Component	Chromosome, centromeric region	IDA	38009294
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0004672	Function	Protein kinase activity	IDA	38009294
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10356987, 18239682
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	16756490
GO:0005515	Function	Protein binding	IPI	15292222, 15910542, 17126281, 21454679, 21988832, 32707033, 33961781, 35271311, 38009294
GO:0005524	Function	ATP binding	IDA	10356987
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	9488481
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IDA	38009294
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10356987
GO:0006915	Process	Apoptotic process	IDA	10580117
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	12917339
GO:0006940	Process	Regulation of smooth muscle contraction	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	TAS
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	21487036
GO:0008140	Function	CAMP response element binding protein binding	TAS	14685163
GO:0008360	Process	Regulation of cell shape	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	TAS	16756490
GO:0016301	Function	Kinase activity	IEA
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IDA	18995835
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030496	Component	Midbody	IDA	38009294
GO:0030496	Component	Midbody	IEA
GO:0031267	Function	Small GTPase binding	IDA	23454120
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	23454120
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10356987
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042802	Function	Identical protein binding	IPI	18239682, 21487036
GO:0042803	Function	Protein homodimerization activity	IDA	18239682
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	16756490
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21487036
GO:0043519	Process	Regulation of myosin II filament organization	IEA
GO:0043522	Function	Leucine zipper domain binding	IPI	10580117
GO:0046777	Process	Protein autophosphorylation	IDA	18239682
GO:0046777	Process	Protein autophosphorylation	TAS	16756490
GO:0051893	Process	Regulation of focal adhesion assembly	IDA	23454120
GO:0071346	Process	Cellular response to type II interferon	IDA	18995835
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	21454679
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000145	Process	Regulation of cell motility	TAS

MIM	HGNC	e!Ensembl
603289	2676	ENSG00000167657

Protein

UniProt ID

O43293

Protein name

Death-associated protein kinase 3 (DAP kinase 3) (EC 2.7.11.1) (DAP-like kinase) (Dlk) (MYPT1 kinase) (Zipper-interacting protein kinase) (ZIP-kinase)

Protein function

Serine/threonine kinase which is involved in the regulation of apoptosis, autophagy, transcription, translation and actin cytoskeleton reorganization. Involved in the regulation of smooth muscle contraction. Regulates both type I (caspase-depend

PDB

1YRP , 2J90 , 3BHY , 3BQR , 5A6N , 5A6O , 5VJA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	13 → 275	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Isoform 1 and isoform 2 are expressed in the bladder smooth muscle. {ECO:0000269|PubMed:15292222, ECO:0000269|PubMed:17126281}.

Sequence

MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR

Sequence length

454

Interactions

View interactions

	KEGG
	Autophagy - animal Pathways in cancer Bladder cancer

DAPK3 (death associated protein kinase 3)