DAPK1 (death associated protein kinase 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1612
Gene name Gene Name - the full gene name approved by the HGNC.
Death associated protein kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DAPK1
Synonyms (NCBI Gene) Gene synonyms aliases
DAPK, ROCO3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(93)
miRTarBase ID miRNA Experiments Reference
MIRT004738 hsa-miR-214-3p Microarray, qRT-PCR 19435428
MIRT004738 hsa-miR-214-3p Microarray, qRT-PCR 19435428
MIRT006690 hsa-miR-103a-3p Luciferase reporter assay, Western blot 22593189
MIRT006690 hsa-miR-103a-3p Luciferase reporter assay, Western blot 22593189
MIRT006691 hsa-miR-107 Luciferase reporter assay, Western blot 22593189
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
CEBPB Unknown 19521987
HOXB7 Repression 17540169
MBD2 Unknown 21693597
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(35)
GO ID Ontology Definition Evidence Reference
GO:0004672 Function Protein kinase activity IDA 7828849, 12730201
GO:0004674 Function Protein serine/threonine kinase activity IBA 21873635
GO:0004674 Function Protein serine/threonine kinase activity TAS 16756490
GO:0004683 Function Calmodulin-dependent protein kinase activity IDA 10629061
GO:0005515 Function Protein binding IPI 15616583, 16132846, 19180116, 19712061, 20389280, 21725354, 25241761, 25852190, 27068745, 28169274, 29513927
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600831 2674 ENSG00000196730
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P53355
Protein name Death-associated protein kinase 1 (DAP kinase 1) (EC 2.7.11.1)
Protein function Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on t
PDB 1IG1 , 1JKK , 1JKL , 1JKS , 1JKT , 1P4F , 1WVW , 1WVX , 1WVY , 1YR5 , 2W4J , 2W4K , 2X0G , 2XUU , 2XZS , 2Y0A , 2Y4P , 2Y4V , 2YAK , 3DFC , 3DGK , 3EH9 , 3EHA , 3F5G , 3F5U , 3GU4 , 3GU5 , 3GU6 , 3GU7 , 3GU8 , 3GUB , 3ZXT , 4B4L , 4PF4 , 4TL0 , 4TXC , 4UV0 , 4YO4 , 4YPD , 5AUT , 5AUU , 5AUV , 5AUW , 5AUX , 5AUY , 5AUZ , 5AV0 , 5AV1 , 5AV2 , 5AV3 , 5AV4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 13 → 275 Protein kinase domain Domain
PF00023 Ank 444 → 476 Ankyrin repeat Repeat
PF00023 Ank 477 → 509 Ankyrin repeat Repeat
PF00023 Ank 510 → 542 Ankyrin repeat Repeat
PF00023 Ank 576 → 608 Ankyrin repeat Repeat
PF00023 Ank 609 → 641 Ankyrin repeat Repeat
PF00531 Death 1310 → 1396 Death domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 2 is expressed in normal intestinal tissue as well as in colorectal carcinomas. {ECO:0000269|PubMed:18422656}.
Sequence 
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
THHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
Sequence length 1430
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Autophagy - animal
Pathways in cancer
Bladder cancer 		 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (9)
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular, Adenoid Cystic Carcinoma rs121913530, rs886039394, rs121913474 15172992, 16762588
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Carcinoma Carcinoma, Cribriform, Carcinoma, Granular Cell rs121912654, rs555607708, rs786202962, rs1564055259 15172992
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 19874806
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Brain neoplasms Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain 17319784 ClinVar
Chromophobe carcinoma Chromophobe Renal Cell Carcinoma 17133271 ClinVar
Autism Spectrum Disorder autism spectrum disorder GenCC
Multiple myeloma Multiple myeloma MM cells lacking PSMC6 also developed resistance against Carfilzomib (CAR) GWAS, CBGDA
Show/Hide Text Mining Associations (124)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Inhibit 17401463
Adenocarcinoma Associate 32998713, 33510126
Adenocarcinoma of Lung Associate 26722491
Adenoma Pleomorphic Associate 23510689
Agnosia Associate 25065733
Alcoholism Inhibit 29790687
Alzheimer Disease Associate 18336955, 18830724, 31279627, 31978714, 35887339
Anemia Refractory with Excess of Blasts Inhibit 25679997
Angina Stable Associate 22420243
Asthma Associate 31924195