Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1610
Gene name	D-amino acid oxidase
Gene symbol	DAO
Synonyms (NCBI Gene)	DAAODAMOXOXDA
Chromosome	12
Chromosome location	12q24.11
Summary	This gene encodes the peroxisomal enzyme D-amino acid oxidase. The enzyme is a flavoprotein which uses flavin adenine dinucleotide (FAD) as its prosthetic group. Its substrates include a wide variety of D-amino acids, but it is inactive on the naturally o

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT724913	hsa-miR-4269	HITS-CLIP	19536157
MIRT724912	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT724911	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT724910	hsa-miR-4673	HITS-CLIP	19536157
MIRT724909	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT724908	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT724906	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT724907	hsa-miR-4656	HITS-CLIP	19536157
MIRT724905	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT724904	hsa-miR-4492	HITS-CLIP	19536157
MIRT724903	hsa-miR-4498	HITS-CLIP	19536157
MIRT724902	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT724901	hsa-miR-762	HITS-CLIP	19536157
MIRT724900	hsa-miR-4675	HITS-CLIP	19536157
MIRT724899	hsa-miR-4741	HITS-CLIP	19536157
MIRT724898	hsa-miR-3147	HITS-CLIP	19536157
MIRT724897	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT724896	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT724895	hsa-miR-4674	HITS-CLIP	19536157
MIRT724894	hsa-miR-1587	HITS-CLIP	19536157
MIRT724893	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT724913	hsa-miR-4269	HITS-CLIP	19536157
MIRT724912	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT724911	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT724910	hsa-miR-4673	HITS-CLIP	19536157
MIRT724909	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT724908	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT724906	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT724907	hsa-miR-4656	HITS-CLIP	19536157
MIRT724905	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT724904	hsa-miR-4492	HITS-CLIP	19536157
MIRT724903	hsa-miR-4498	HITS-CLIP	19536157
MIRT724902	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT724901	hsa-miR-762	HITS-CLIP	19536157
MIRT724900	hsa-miR-4675	HITS-CLIP	19536157
MIRT724899	hsa-miR-4741	HITS-CLIP	19536157
MIRT724898	hsa-miR-3147	HITS-CLIP	19536157
MIRT724897	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT724896	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT724895	hsa-miR-4674	HITS-CLIP	19536157
MIRT724894	hsa-miR-1587	HITS-CLIP	19536157
MIRT724893	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT2209041	hsa-miR-1	CLIP-seq
MIRT2209042	hsa-miR-206	CLIP-seq
MIRT2209043	hsa-miR-3673	CLIP-seq
MIRT2209044	hsa-miR-490-5p	CLIP-seq
MIRT2209045	hsa-miR-613	CLIP-seq

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003884	Function	D-amino-acid oxidase activity	IBA
GO:0003884	Function	D-amino-acid oxidase activity	IDA	12364586, 16616139, 17303072, 18544534, 19309736, 20567862, 20603179, 23219954, 29274788, 29326945, 32730563
GO:0003884	Function	D-amino-acid oxidase activity	IEA
GO:0003884	Function	D-amino-acid oxidase activity	IMP	29274788
GO:0005515	Function	Protein binding	IPI	12364586, 20521334, 21679769, 21988832, 24722188, 25416956, 28514442, 29274788, 31515488, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17880399
GO:0005737	Component	Cytoplasm	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	21679769
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	IDA	17684499, 18544534, 21679769, 23219954, 31799256
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005782	Component	Peroxisomal matrix	ISS
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IDA	18544534, 31799256
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006551	Process	L-leucine metabolic process	IEA
GO:0006562	Process	L-proline catabolic process	IBA
GO:0006562	Process	L-proline catabolic process	IDA	16616139
GO:0007586	Process	Digestion	IEA
GO:0007586	Process	Digestion	ISS
GO:0008718	Function	D-amino-acid dehydrogenase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019478	Process	D-amino acid catabolic process	IDA	29274788
GO:0036088	Process	D-serine catabolic process	IBA
GO:0036088	Process	D-serine catabolic process	IDA	18544534
GO:0042416	Process	Dopamine biosynthetic process	IDA	17303072
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IPI	16616139, 19309736
GO:0042995	Component	Cell projection	IEA
GO:0043799	Function	Glycine oxidase activity	IEA
GO:0045202	Component	Synapse	IEA
GO:0046416	Process	D-amino acid metabolic process	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0048786	Component	Presynaptic active zone	ISS
GO:0051873	Process	Killing by host of symbiont cells	IEA
GO:0055130	Process	D-alanine catabolic process	IBA
GO:0055130	Process	D-alanine catabolic process	IDA	16616139, 20603179
GO:0055130	Process	D-alanine catabolic process	IEA
GO:0070178	Process	D-serine metabolic process	IDA	21679769
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	IEA
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	ISS
GO:0071949	Function	FAD binding	IDA	16616139, 19309736, 20521334, 20603179, 29326945, 32730563
GO:0071949	Function	FAD binding	IEA
GO:0071949	Function	FAD binding	IMP	29274788
GO:0170035	Process	L-amino acid catabolic process	IEA
GO:0170040	Process	Proteinogenic amino acid catabolic process	IEA

MIM	HGNC	e!Ensembl
124050	2671	ENSG00000110887

P14920

Protein name

D-amino-acid oxidase (DAAO) (DAMOX) (DAO) (EC 1.4.3.3)

Protein function

Catalyzes the oxidative deamination of D-amino acids with broad substrate specificity (PubMed:16616139, PubMed:17088322, PubMed:17303072, PubMed:18544534, PubMed:20368421, PubMed:20567862, PubMed:20603179, PubMed:22203986, PubMed:23219954, PubMe

PDB

2DU8 , 2E48 , 2E49 , 2E4A , 2E82 , 3CUK , 3G3E , 3W4I , 3W4J , 3W4K , 3ZNN , 3ZNO , 3ZNP , 3ZNQ , 4QFC , 4QFD , 5ZJ9 , 5ZJA , 6KBP , 7U9S , 7U9U , 8HY5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01266	DAO	2 → 329	FAD dependent oxidoreductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the cerebellum, in astrocytes of the cortex, in motor neurons and fibers of the lumbar spinal cord (at protein level) (PubMed:17880399, PubMed:18544534, PubMed:18560437, PubMed:24138986, PubMed:34041270). Expressed in gobl

Sequence

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL

Sequence length

347

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism Arginine and proline metabolism D-Amino acid metabolism Metabolic pathways Peroxisome		Glyoxylate metabolism and glycine degradation Peroxisomal protein import

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Amyotrophic lateral sclerosis	Uncertain significance; Conflicting classifications of pathogenicity	rs373913310, rs778735604, rs138277420, rs2039610204, rs781658657	RCV001843917 RCV001095492 RCV001095493 RCV001095495 RCV001260559
Cholangiocarcinoma	Benign	rs7980427	RCV005920343
DAO-related disorder	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	rs7980427, rs531892910, rs773765064, rs368093324, rs2039476497, rs760432003, rs372560295, rs147144733, rs143732132, rs139166976, rs200350184, rs146917361, rs181080261, rs779881826, rs768403852 View all (17 more)	RCV003975995 RCV003402634 RCV003414528 RCV003414555 RCV003400183 RCV003419090 RCV003392849 RCV003418824 RCV003946633 RCV003919573 RCV003964569 RCV003912267 RCV003899298 RCV003911670 RCV003914028 RCV003951953 RCV003949450 RCV003969337 RCV003949160 RCV003946805 RCV003946946 RCV003956731 RCV003969689 RCV003954796 RCV003969081 RCV003910811 RCV003968184 RCV003912842 RCV003932958 RCV003933002 RCV003396745 RCV003399030
Thymoma	Benign	rs7980427	RCV005920342

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Associate	23755159, 33051492
Anxiety	Associate	21471957
Bipolar Disorder	Associate	16380905
Carcinoma Renal Cell	Associate	38297313
Colorectal Neoplasms	Associate	33540681
Darier Disease	Associate	26440917
Drug Related Side Effects and Adverse Reactions	Stimulate	33540681
Exostoses	Associate	34582124
Glioblastoma	Associate	33540681
Glutamate formiminotransferase deficiency	Associate	19077230
Mental Disorders	Associate	26440917, 32818236
Migraine Disorders	Associate	27130307
Mood Disorders	Associate	26440917
Neoplasm Metastasis	Associate	28430663
Neoplasms	Associate	33540681
Obesity	Associate	32818236
Psychotic Disorders	Associate	21391259
Schizophrenia	Associate	21471957, 23219954, 26440917
Stiff Person Syndrome	Associate	21471957

DAO (D-amino acid oxidase)