Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1609
Gene name Gene Name - the full gene name approved by the HGNC.	Diacylglycerol kinase theta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DGKQ
Synonyms (NCBI Gene) Gene synonyms aliases	DAGK, DAGK4, DAGK7
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene contains three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain. It is localized in the speckle domains of the nucleus, and mediates the regeneration

Show/Hide all(118)

miRTarBase ID	miRNA	Experiments
MIRT934242	hsa-miR-1228	CLIP-seq
MIRT934243	hsa-miR-1237	CLIP-seq
MIRT934244	hsa-miR-1286	CLIP-seq
MIRT934245	hsa-miR-1292	CLIP-seq
MIRT934246	hsa-miR-133a	CLIP-seq
MIRT934247	hsa-miR-133b	CLIP-seq
MIRT934248	hsa-miR-140-3p	CLIP-seq
MIRT934249	hsa-miR-1908	CLIP-seq
MIRT934250	hsa-miR-1915	CLIP-seq
MIRT934251	hsa-miR-197	CLIP-seq
MIRT934252	hsa-miR-2467-5p	CLIP-seq
MIRT934253	hsa-miR-3126-5p	CLIP-seq
MIRT934254	hsa-miR-3135b	CLIP-seq
MIRT934255	hsa-miR-3136-3p	CLIP-seq
MIRT934256	hsa-miR-3140-3p	CLIP-seq
MIRT934257	hsa-miR-3141	CLIP-seq
MIRT934258	hsa-miR-3188	CLIP-seq
MIRT934259	hsa-miR-3199	CLIP-seq
MIRT934260	hsa-miR-329	CLIP-seq
MIRT934261	hsa-miR-342-3p	CLIP-seq
MIRT934262	hsa-miR-362-3p	CLIP-seq
MIRT934263	hsa-miR-3652	CLIP-seq
MIRT934264	hsa-miR-3689d	CLIP-seq
MIRT934265	hsa-miR-370	CLIP-seq
MIRT934266	hsa-miR-377	CLIP-seq
MIRT934267	hsa-miR-3941	CLIP-seq
MIRT934268	hsa-miR-3975	CLIP-seq
MIRT934269	hsa-miR-4269	CLIP-seq
MIRT934270	hsa-miR-4281	CLIP-seq
MIRT934271	hsa-miR-4314	CLIP-seq
MIRT934272	hsa-miR-4316	CLIP-seq
MIRT934273	hsa-miR-4430	CLIP-seq
MIRT934274	hsa-miR-4436a	CLIP-seq
MIRT934275	hsa-miR-4471	CLIP-seq
MIRT934276	hsa-miR-4515	CLIP-seq
MIRT934277	hsa-miR-4646-5p	CLIP-seq
MIRT934278	hsa-miR-466	CLIP-seq
MIRT934279	hsa-miR-4672	CLIP-seq
MIRT934280	hsa-miR-4685-5p	CLIP-seq
MIRT934281	hsa-miR-4700-3p	CLIP-seq
MIRT934282	hsa-miR-4706	CLIP-seq
MIRT934283	hsa-miR-4710	CLIP-seq
MIRT934284	hsa-miR-4722-5p	CLIP-seq
MIRT934285	hsa-miR-4749-3p	CLIP-seq
MIRT934286	hsa-miR-4749-5p	CLIP-seq
MIRT934287	hsa-miR-485-3p	CLIP-seq
MIRT934288	hsa-miR-485-5p	CLIP-seq
MIRT934289	hsa-miR-603	CLIP-seq
MIRT934290	hsa-miR-663	CLIP-seq
MIRT934291	hsa-miR-885-3p	CLIP-seq
MIRT934292	hsa-miR-935	CLIP-seq
MIRT1976574	hsa-miR-193a-3p	CLIP-seq
MIRT1976575	hsa-miR-193b	CLIP-seq
MIRT1976576	hsa-miR-214	CLIP-seq
MIRT934252	hsa-miR-2467-5p	CLIP-seq
MIRT934254	hsa-miR-3135b	CLIP-seq
MIRT934255	hsa-miR-3136-3p	CLIP-seq
MIRT1976577	hsa-miR-3169	CLIP-seq
MIRT1976578	hsa-miR-3184	CLIP-seq
MIRT934258	hsa-miR-3188	CLIP-seq
MIRT1976579	hsa-miR-3619-5p	CLIP-seq
MIRT934263	hsa-miR-3652	CLIP-seq
MIRT934264	hsa-miR-3689d	CLIP-seq
MIRT1976580	hsa-miR-3690	CLIP-seq
MIRT934268	hsa-miR-3975	CLIP-seq
MIRT1976581	hsa-miR-423-5p	CLIP-seq
MIRT934269	hsa-miR-4269	CLIP-seq
MIRT934272	hsa-miR-4316	CLIP-seq
MIRT934273	hsa-miR-4430	CLIP-seq
MIRT1976582	hsa-miR-4435	CLIP-seq
MIRT1976583	hsa-miR-4477b	CLIP-seq
MIRT934276	hsa-miR-4515	CLIP-seq
MIRT1976584	hsa-miR-4688	CLIP-seq
MIRT1976585	hsa-miR-4690-5p	CLIP-seq
MIRT934283	hsa-miR-4710	CLIP-seq
MIRT1976586	hsa-miR-4716-3p	CLIP-seq
MIRT934288	hsa-miR-485-5p	CLIP-seq
MIRT1976587	hsa-miR-761	CLIP-seq
MIRT934242	hsa-miR-1228	CLIP-seq
MIRT2211939	hsa-miR-1825	CLIP-seq
MIRT1976574	hsa-miR-193a-3p	CLIP-seq
MIRT1976575	hsa-miR-193b	CLIP-seq
MIRT934252	hsa-miR-2467-5p	CLIP-seq
MIRT934254	hsa-miR-3135b	CLIP-seq
MIRT1976577	hsa-miR-3169	CLIP-seq
MIRT934258	hsa-miR-3188	CLIP-seq
MIRT934261	hsa-miR-342-3p	CLIP-seq
MIRT934263	hsa-miR-3652	CLIP-seq
MIRT934264	hsa-miR-3689d	CLIP-seq
MIRT1976580	hsa-miR-3690	CLIP-seq
MIRT934268	hsa-miR-3975	CLIP-seq
MIRT934269	hsa-miR-4269	CLIP-seq
MIRT2211940	hsa-miR-4284	CLIP-seq
MIRT934272	hsa-miR-4316	CLIP-seq
MIRT934273	hsa-miR-4430	CLIP-seq
MIRT1976582	hsa-miR-4435	CLIP-seq
MIRT2211941	hsa-miR-4457	CLIP-seq
MIRT1976583	hsa-miR-4477b	CLIP-seq
MIRT2211942	hsa-miR-4494	CLIP-seq
MIRT934276	hsa-miR-4515	CLIP-seq
MIRT934280	hsa-miR-4685-5p	CLIP-seq
MIRT1976584	hsa-miR-4688	CLIP-seq
MIRT934282	hsa-miR-4706	CLIP-seq
MIRT934283	hsa-miR-4710	CLIP-seq
MIRT1976586	hsa-miR-4716-3p	CLIP-seq
MIRT2211943	hsa-miR-4733-3p	CLIP-seq
MIRT934286	hsa-miR-4749-5p	CLIP-seq
MIRT934288	hsa-miR-485-5p	CLIP-seq
MIRT2211944	hsa-miR-486-3p	CLIP-seq
MIRT934291	hsa-miR-885-3p	CLIP-seq
MIRT2211941	hsa-miR-4457	CLIP-seq
MIRT2386877	hsa-miR-4758-3p	CLIP-seq
MIRT2436806	hsa-miR-22	CLIP-seq
MIRT2436807	hsa-miR-4742-3p	CLIP-seq
MIRT2436808	hsa-miR-4769-3p	CLIP-seq
MIRT2436806	hsa-miR-22	CLIP-seq
MIRT2436807	hsa-miR-4742-3p	CLIP-seq
MIRT2436808	hsa-miR-4769-3p	CLIP-seq

Show/Hide all(74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IBA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IDA	9099683, 10066731, 11309392, 15632189, 22627129, 23949095
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IEA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IMP	23091060
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	ISS
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	TAS
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IDA	22732145
GO:0005515	Function	Protein binding	IPI	10066731, 23091060, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	15632189, 17664281, 23610160
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	15632189, 23610160
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	22732145
GO:0005829	Component	Cytosol	IDA	10066731, 22627129, 23091060
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IDA	10066731
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	10066731, 15632189, 22732145
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006111	Process	Regulation of gluconeogenesis	IMP	23767959
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	17664281
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006654	Process	Phosphatidic acid biosynthetic process	IDA	9099683, 22732145, 23949095
GO:0006654	Process	Phosphatidic acid biosynthetic process	IMP	23610160, 23767959
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IGI	22732145
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	22732145
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IMP	24369117
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	15632189
GO:0008270	Function	Zinc ion binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	24369117
GO:0010629	Process	Negative regulation of gene expression	IMP	24369117
GO:0012506	Component	Vesicle membrane	IDA	23091060
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016363	Component	Nuclear matrix	ISS
GO:0016607	Component	Nuclear speck	IDA	12799190
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019900	Function	Kinase binding	IPI	15632189
GO:0030168	Process	Platelet activation	IEA
GO:0030168	Process	Platelet activation	TAS
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IGI	22732145
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	22732145
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0043274	Function	Phospholipase binding	IPI	12799190
GO:0045202	Component	Synapse	IEA
GO:0046339	Process	Diacylglycerol metabolic process	IDA	9099683, 11309392, 22627129, 23949095
GO:0046486	Process	Glycerolipid metabolic process	IBA
GO:0046486	Process	Glycerolipid metabolic process	IDA	22627129
GO:0046486	Process	Glycerolipid metabolic process	IEA
GO:0046834	Process	Lipid phosphorylation	IDA	9099683, 11309392, 22627129, 23949095
GO:0046872	Function	Metal ion binding	IEA
GO:0047649	Function	Alkylglycerol kinase activity	IEA
GO:0051591	Process	Response to cAMP	IDA	23610160
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	15632189
GO:0090037	Process	Positive regulation of protein kinase C signaling	IDA	22732145
GO:0090181	Process	Regulation of cholesterol metabolic process	IMP	24369117
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	17664281
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1903413	Process	Cellular response to bile acid	IMP	23767959
GO:1903432	Process	Regulation of TORC1 signaling	IMP	23767959
GO:2000064	Process	Regulation of cortisol biosynthetic process	IMP	24369117
GO:2000182	Process	Regulation of progesterone biosynthetic process	IMP	24369117

MIM	HGNC	e!Ensembl
601207	2856	ENSG00000145214

Protein

UniProt ID

P52824

Protein name

Diacylglycerol kinase theta (DAG kinase theta) (DGKtheta) (EC 2.7.1.107) (EC 2.7.1.93) (Diglyceride kinase theta) (DGK-theta)

Protein function

Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids (PubMed:11309392, PubMed:22627129, PubMed:9099683). Thereby, acts as a central switc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00130	C1_1	61 → 110	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00130	C1_1	184 → 237	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00788	RA	395 → 494	Ras association (RalGDS/AF-6) domain	Domain
PF00781	DAGK_cat	588 → 712	Diacylglycerol kinase catalytic domain	Family
PF00609	DAGK_acc	741 → 893	Diacylglycerol kinase accessory domain	Family

Sequence

MAAAAEPGARAWLGGGSPRPGSPACSPVLGSGGRARPGPGPGPGPERAGVRAPGPAAAPG
HSFRKVTLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPV
AHCFGPRGLHKRKFCAVCRKVLEAPALHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHD
THHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLR
SLVLPPACVRLLPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTL
KIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAW
AGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPK
STARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVR
QVSQTRFYVAESRDVAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQG
AVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGL
KGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEET
RYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPFSVLLSVDEADAVLMDRWTILLD
AHEAGSAENDTADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYV
RVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKP
RMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGH
MIISAAGPKVHMLRKAKQKPRRAGTTRDARADAAPAPESDPR

Sequence length

942

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Glycerophospholipid metabolism Metabolic pathways Phosphatidylinositol signaling system Phospholipase D signaling pathway Choline metabolism in cancer		Effects of PIP2 hydrolysis

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS
Polymyositis	Polymyositis	N/A	N/A	GWAS
Sjogren-Larsson Syndrome	Sjogren-Larsson Syndrome	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	40631452
Breast Neoplasms	Associate	29965997
Carcinoma Hepatocellular	Associate	29207074, 31514484
Fatty Liver	Associate	29207074
Insulin Resistance	Associate	29207074
Parkinson Disease	Associate	18985386, 21248740, 23071545, 25997059, 27508417, 36759259
Sjogren's Syndrome	Associate	24097067

DGKQ (diacylglycerol kinase theta)