Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	160728
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 5 member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC5A8
Synonyms (NCBI Gene) Gene synonyms aliases	AIT, SMCT, SMCT1
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q23.1-q23.2
Summary Summary of gene provided in NCBI Entrez Gene.	SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 [PubMed 15322102]). In kidney, SLC5A8 functions

Show/Hide all(74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT642846	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT642845	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT642844	hsa-miR-570-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT629269	hsa-miR-8485	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT525850	hsa-miR-4305	PAR-CLIP	20371350
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	20371350
MIRT525851	hsa-miR-3156-5p	PAR-CLIP	22012620
MIRT525850	hsa-miR-4305	PAR-CLIP	22012620
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	22012620
MIRT642846	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT642845	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT642844	hsa-miR-570-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT629269	hsa-miR-8485	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT525850	hsa-miR-4305	PAR-CLIP	20371350
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	20371350
MIRT525851	hsa-miR-3156-5p	PAR-CLIP	22012620
MIRT525850	hsa-miR-4305	PAR-CLIP	22012620
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	22012620
MIRT1365831	hsa-miR-2278	CLIP-seq
MIRT1365832	hsa-miR-3171	CLIP-seq
MIRT1365833	hsa-miR-3185	CLIP-seq
MIRT1365834	hsa-miR-325	CLIP-seq
MIRT1365835	hsa-miR-361-5p	CLIP-seq
MIRT1365836	hsa-miR-3646	CLIP-seq
MIRT1365837	hsa-miR-4275	CLIP-seq
MIRT1365838	hsa-miR-4477b	CLIP-seq
MIRT1365839	hsa-miR-4506	CLIP-seq
MIRT1365840	hsa-miR-4633-3p	CLIP-seq
MIRT1365841	hsa-miR-4709-3p	CLIP-seq
MIRT1365842	hsa-miR-4804-3p	CLIP-seq
MIRT1365843	hsa-miR-628-3p	CLIP-seq
MIRT1365844	hsa-miR-646	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT2108633	hsa-miR-1285	CLIP-seq
MIRT2108634	hsa-miR-3187-5p	CLIP-seq
MIRT2108635	hsa-miR-3653	CLIP-seq
MIRT2108636	hsa-miR-3658	CLIP-seq
MIRT2108637	hsa-miR-369-3p	CLIP-seq
MIRT2108638	hsa-miR-3945	CLIP-seq
MIRT2108639	hsa-miR-4253	CLIP-seq
MIRT1365839	hsa-miR-4506	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT2108640	hsa-miR-548c-3p	CLIP-seq
MIRT2108641	hsa-miR-577	CLIP-seq
MIRT2108642	hsa-miR-612	CLIP-seq
MIRT2332237	hsa-miR-214	CLIP-seq
MIRT2332238	hsa-miR-2682	CLIP-seq
MIRT2332239	hsa-miR-3619-5p	CLIP-seq
MIRT2108635	hsa-miR-3653	CLIP-seq
MIRT2108636	hsa-miR-3658	CLIP-seq
MIRT2332240	hsa-miR-3668	CLIP-seq
MIRT2108637	hsa-miR-369-3p	CLIP-seq
MIRT2332241	hsa-miR-3714	CLIP-seq
MIRT2332242	hsa-miR-4291	CLIP-seq
MIRT2332243	hsa-miR-4310	CLIP-seq
MIRT2332244	hsa-miR-449c	CLIP-seq
MIRT1365839	hsa-miR-4506	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT2332245	hsa-miR-5096	CLIP-seq
MIRT2332246	hsa-miR-513b	CLIP-seq
MIRT2332247	hsa-miR-548an	CLIP-seq
MIRT2332248	hsa-miR-570	CLIP-seq
MIRT2332249	hsa-miR-618	CLIP-seq
MIRT2332250	hsa-miR-761	CLIP-seq
MIRT2332251	hsa-miR-922	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CEBPB	Activation	20082847
SP1	Activation	20082847

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005343	Function	Organic acid:sodium symporter activity	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Ion transport	TAS
GO:0006814	Process	Sodium ion transport	IBA	21873635
GO:0006915	Process	Apoptotic process	IEA
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	TAS
GO:0015129	Function	Lactate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IBA	21873635
GO:0015552	Function	Propionate transmembrane transporter activity	IEA
GO:0015730	Process	Propanoate transport	IBA	21873635
GO:0015913	Process	Short-chain fatty acid import	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022803	Function	Passive transmembrane transporter activity	TAS
GO:0034356	Process	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS
GO:0035873	Process	Lactate transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0140161	Function	Monocarboxylate:sodium symporter activity	IEA

MIM	HGNC	e!Ensembl
608044	19119	ENSG00000256870

Protein

UniProt ID

Q8N695

Protein name

Sodium-coupled monocarboxylate transporter 1 (Apical iodide transporter) (Electrogenic sodium monocarboxylate cotransporter) (Sodium iodide-related cotransporter) (Solute carrier family 5 member 8)

Protein function

Acts as an electrogenic sodium (Na(+)) and chloride (Cl-)-dependent sodium-coupled solute transporter, including transport of monocarboxylates (short-chain fatty acids including L-lactate, D-lactate, pyruvate, acetate, propionate, valerate and b

PDB

7SL9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00474	SSF	45 → 449	Sodium:solute symporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal thyroid, localized at the apical pole of thyroid cells facing the colloid lumen, but expression profoundly decreased in thyroid carcinomas. Expressed in normal colon but absent in colon aberrant crypt foci and colon

Sequence

MDTPRGIGTFVVWDYVVFAGMLVISAAIGIYYAFAGGGQQTSKDFLMGGRRMTAVPVALS
LTASFMSAVTVLGTPSEVYRFGAIFSIFAFTYFFVVVISAEVFLPVFYKLGITSTYEYLE
LRFNKCVRLCGTVLFIVQTILYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTLG
GLKAVIWTDVFQVGIMVAGFASVIIQAVVMQGGISTILNDAYDGGRLNFWNFNPNPLQRH
TFWTIIIGGTFTWTSIYGVNQSQVQRYISCKSRFQAKLSLYINLVGLWAILTCSVFCGLA
LYSRYHDCDPWTAKKVSAPDQLMPYLVLDILQDYPGLPGLFVACAYSGTLSTVSSSINAL
AAVTVEDLIKPYFRSLSERSLSWISQGMSVVYGALCIGMAALASLMGALLQAALSVFGMV
GGPLMGLFALGILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
NSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGTLVTLLVGILVS
LSTGGRKQNLDPRYILTKEDFLSNFDIFKKKKHVLSYKSHPVEDGGTDNPAFNHIELNSD
QSGKSNGTRL

Sequence length

610

Interactions

View interactions

	Reactome
			Nicotinamide salvaging Organic anion transporters

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15090606, 16670197

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	15389252, 21687703
Carcinogenesis	Associate	21687703, 21802122
Carcinoma Hepatocellular	Inhibit	27465549
Carcinoma Pancreatic Ductal	Associate	22450368
Carcinoma Renal Cell	Associate	35456426
Colonic Diseases	Associate	12829793, 21687703
Colorectal Neoplasms	Associate	12829793, 15361710, 28333199, 28874966, 38049731
Dental Caries	Associate	36981009
Dyslipidemias	Associate	37582372
Helicobacter Infections	Associate	27777899
Inflammation	Associate	28333199
Irritable Bowel Syndrome	Associate	33625995
Leukemia Myeloid Acute	Associate	18566324
Lung Neoplasms	Associate	23273563
Neoplasms	Inhibit	12829793, 15361710, 18566324, 21802122, 23273563, 27777899, 30896789
Neoplasms	Associate	15389252, 22450368, 27465549, 33278617, 35456426
Pancreatic Neoplasms	Inhibit	22450368
Prostatic Neoplasms	Associate	21802122
Prostatic stromal proliferation of uncertain malignant potential	Associate	38007446
Stomach Neoplasms	Associate	15361710
Sveinsson Chorioretinal Atrophy	Associate	21687703
Thyroid cancer follicular	Associate	38007446
Thyroid Cancer Papillary	Associate	39408960
Uterine Cervical Neoplasms	Inhibit	30896789, 32432731
Vitamin D Deficiency	Associate	33625995

SLC5A8 (solute carrier family 5 member 8)