Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	160728
Gene name	Solute carrier family 5 member 8
Gene symbol	SLC5A8
Synonyms (NCBI Gene)	AITSMCTSMCT1
Chromosome	12
Chromosome location	12q23.1-q23.2
Summary	SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 [PubMed 15322102]). In kidney, SLC5A8 functions

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT642846	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT642845	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT642844	hsa-miR-570-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT629269	hsa-miR-8485	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT525850	hsa-miR-4305	PAR-CLIP	20371350
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	20371350
MIRT525851	hsa-miR-3156-5p	PAR-CLIP	22012620
MIRT525850	hsa-miR-4305	PAR-CLIP	22012620
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	22012620
MIRT642846	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT642845	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT642844	hsa-miR-570-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT629269	hsa-miR-8485	HITS-CLIP	23824327
MIRT629268	hsa-miR-3151-3p	HITS-CLIP	23824327
MIRT629267	hsa-miR-640	HITS-CLIP	23824327
MIRT525850	hsa-miR-4305	PAR-CLIP	20371350
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	20371350
MIRT525851	hsa-miR-3156-5p	PAR-CLIP	22012620
MIRT525850	hsa-miR-4305	PAR-CLIP	22012620
MIRT525849	hsa-miR-4777-3p	PAR-CLIP	22012620
MIRT1365831	hsa-miR-2278	CLIP-seq
MIRT1365832	hsa-miR-3171	CLIP-seq
MIRT1365833	hsa-miR-3185	CLIP-seq
MIRT1365834	hsa-miR-325	CLIP-seq
MIRT1365835	hsa-miR-361-5p	CLIP-seq
MIRT1365836	hsa-miR-3646	CLIP-seq
MIRT1365837	hsa-miR-4275	CLIP-seq
MIRT1365838	hsa-miR-4477b	CLIP-seq
MIRT1365839	hsa-miR-4506	CLIP-seq
MIRT1365840	hsa-miR-4633-3p	CLIP-seq
MIRT1365841	hsa-miR-4709-3p	CLIP-seq
MIRT1365842	hsa-miR-4804-3p	CLIP-seq
MIRT1365843	hsa-miR-628-3p	CLIP-seq
MIRT1365844	hsa-miR-646	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT2108633	hsa-miR-1285	CLIP-seq
MIRT2108634	hsa-miR-3187-5p	CLIP-seq
MIRT2108635	hsa-miR-3653	CLIP-seq
MIRT2108636	hsa-miR-3658	CLIP-seq
MIRT2108637	hsa-miR-369-3p	CLIP-seq
MIRT2108638	hsa-miR-3945	CLIP-seq
MIRT2108639	hsa-miR-4253	CLIP-seq
MIRT1365839	hsa-miR-4506	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT2108640	hsa-miR-548c-3p	CLIP-seq
MIRT2108641	hsa-miR-577	CLIP-seq
MIRT2108642	hsa-miR-612	CLIP-seq
MIRT2332237	hsa-miR-214	CLIP-seq
MIRT2332238	hsa-miR-2682	CLIP-seq
MIRT2332239	hsa-miR-3619-5p	CLIP-seq
MIRT2108635	hsa-miR-3653	CLIP-seq
MIRT2108636	hsa-miR-3658	CLIP-seq
MIRT2332240	hsa-miR-3668	CLIP-seq
MIRT2108637	hsa-miR-369-3p	CLIP-seq
MIRT2332241	hsa-miR-3714	CLIP-seq
MIRT2332242	hsa-miR-4291	CLIP-seq
MIRT2332243	hsa-miR-4310	CLIP-seq
MIRT2332244	hsa-miR-449c	CLIP-seq
MIRT1365839	hsa-miR-4506	CLIP-seq
MIRT1553823	hsa-miR-4738-3p	CLIP-seq
MIRT2332245	hsa-miR-5096	CLIP-seq
MIRT2332246	hsa-miR-513b	CLIP-seq
MIRT2332247	hsa-miR-548an	CLIP-seq
MIRT2332248	hsa-miR-570	CLIP-seq
MIRT2332249	hsa-miR-618	CLIP-seq
MIRT2332250	hsa-miR-761	CLIP-seq
MIRT2332251	hsa-miR-922	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CEBPB	Activation	20082847
SP1	Activation	20082847

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000811	Component	GINS complex	IEA
GO:0005343	Function	Organic acid:sodium symporter activity	IBA
GO:0005343	Function	Organic acid:sodium symporter activity	IEA
GO:0005515	Function	Protein binding	IPI	30604288
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IBA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006821	Process	Chloride transport	IDA	19864324
GO:0006846	Process	Acetate transport	IDA	14966140, 15090606
GO:0006848	Process	Pyruvate transport	IDA	14966140, 15090606, 16805814, 17178845
GO:0006915	Process	Apoptotic process	IEA
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	TAS
GO:0015129	Function	Lactate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015370	Function	Solute:sodium symporter activity	IEA
GO:0015552	Function	Propionate transmembrane transporter activity	IEA
GO:0015636	Function	Short-chain fatty acid transmembrane transporter activity	IEA
GO:0015705	Process	Iodide transport	IDA	12107270, 19864324
GO:0015706	Process	Nitrate transmembrane transport	IDA	19864324
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0015727	Process	Lactate transport	IDA	14966140, 15090606, 16805814, 17526579
GO:0015730	Process	Propanoate transmembrane transport	IBA
GO:0015730	Process	Propanoate transmembrane transport	IDA	14966140, 15090606, 16729224, 17526579
GO:0015730	Process	Propanoate transmembrane transport	IEA
GO:0015913	Process	Short-chain fatty acid transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	12107270, 17245649
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0034355	Process	NAD+ biosynthetic process via the salvage pathway	TAS
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0035873	Process	Lactate transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0140161	Function	Monocarboxylate:sodium symporter activity	IDA	14966140, 15090606, 16729224, 16805814, 17178845, 17245649, 17526579, 20211600, 30604288
GO:0140161	Function	Monocarboxylate:sodium symporter activity	IEA
GO:0160081	Function	Iodide channel activity	TAS
GO:2001142	Process	Nicotinate transport	IDA	14966140, 15090606, 16729224, 17178845, 17245649, 20211600, 30604288
GO:2001142	Process	Nicotinate transport	IEA

MIM	HGNC	e!Ensembl
608044	19119	ENSG00000256870

Q8N695

Protein name

Sodium-coupled monocarboxylate transporter 1 (Apical iodide transporter) (Electrogenic sodium monocarboxylate cotransporter) (Sodium iodide-related cotransporter) (Solute carrier family 5 member 8)

Protein function

Acts as an electrogenic sodium (Na(+)) and chloride (Cl-)-dependent sodium-coupled solute transporter, including transport of monocarboxylates (short-chain fatty acids including L-lactate, D-lactate, pyruvate, acetate, propionate, valerate and b

PDB

7SL9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00474	SSF	45 → 449	Sodium:solute symporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal thyroid, localized at the apical pole of thyroid cells facing the colloid lumen, but expression profoundly decreased in thyroid carcinomas. Expressed in normal colon but absent in colon aberrant crypt foci and colon

Sequence

MDTPRGIGTFVVWDYVVFAGMLVISAAIGIYYAFAGGGQQTSKDFLMGGRRMTAVPVALS
LTASFMSAVTVLGTPSEVYRFGAIFSIFAFTYFFVVVISAEVFLPVFYKLGITSTYEYLE
LRFNKCVRLCGTVLFIVQTILYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTLG
GLKAVIWTDVFQVGIMVAGFASVIIQAVVMQGGISTILNDAYDGGRLNFWNFNPNPLQRH
TFWTIIIGGTFTWTSIYGVNQSQVQRYISCKSRFQAKLSLYINLVGLWAILTCSVFCGLA
LYSRYHDCDPWTAKKVSAPDQLMPYLVLDILQDYPGLPGLFVACAYSGTLSTVSSSINAL
AAVTVEDLIKPYFRSLSERSLSWISQGMSVVYGALCIGMAALASLMGALLQAALSVFGMV
GGPLMGLFALGILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
NSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGTLVTLLVGILVS
LSTGGRKQNLDPRYILTKEDFLSNFDIFKKKKHVLSYKSHPVEDGGTDNPAFNHIELNSD
QSGKSNGTRL

Sequence length

610

Interactions

View interactions

	Reactome
			Nicotinamide salvaging Organic anion transporters

SLC5A8 (solute carrier family 5 member 8)