Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
160365
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLECL1
Synonyms (NCBI Gene) Gene synonyms aliases
CLECL1P, DCAL-1, DCAL1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation o
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IDA 12421943
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
GO:0030246 Function Carbohydrate binding IEA
GO:0032753 Process Positive regulation of interleukin-4 production IDA 12421943
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607467 24462 HGNC
Protein
UniProt ID Q8IZS7
Protein name Putative C-type lectin-like domain family 1 (C-type lectin-like domain family 1 pseudogene) (Dendritic cell-associated lectin 1) (DC-associated lectin-1) (DCAL-1)
Protein function May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immun
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, lymph node, and tonsil. Lower expression in peripheral blood, bone marrow, and colon. No expression detected in thymus. Highly expressed in dendritic and B-cells. {ECO:0000269|PubMed:12421943}.
Sequence
MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIYLSEVSLQKYD
CPFSGTSFVVFSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
DWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Sequence length 167
Interactions View interactions
<