CLECL1 (C-type lectin like 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 160365
Gene name C-type lectin like 1
Gene symbol CLECL1
Synonyms (NCBI Gene)
CLECL1PDCAL-1DCAL1
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation o
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene Gene ontology Other IDs Protein
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IDA 12421943
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
GO:0030246 Function Carbohydrate binding IEA
GO:0032753 Process Positive regulation of interleukin-4 production IDA 12421943
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
607467 24462 HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IZS7
Protein name Putative C-type lectin-like domain family 1 (C-type lectin-like domain family 1 pseudogene) (Dendritic cell-associated lectin 1) (DC-associated lectin-1) (DCAL-1)
Protein function May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immun
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, lymph node, and tonsil. Lower expression in peripheral blood, bone marrow, and colon. No expression detected in thymus. Highly expressed in dendritic and B-cells. {ECO:0000269|PubMed:12421943}.
Sequence 
MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIYLSEVSLQKYD
CPFSGTSFVVFSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
DWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Sequence length 167
Interactions View interactions