Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID	1602
Gene name	Dachshund family transcription factor 1
Gene symbol	DACH1
Synonyms (NCBI Gene)	DACH
Chromosome	13
Chromosome location	13q21.33
Summary	This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Droso

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018559	hsa-miR-335-5p	Microarray	18185580
MIRT054838	hsa-miR-217	Luciferase reporter assay/Western blotqRT-PCR	25653720
MIRT734493	hsa-miR-552-3p	ChIP-seqImmunohistochemistry (IHC)In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33867818
MIRT922624	hsa-miR-15a	CLIP-seq
MIRT922625	hsa-miR-15b	CLIP-seq
MIRT922626	hsa-miR-16	CLIP-seq
MIRT922627	hsa-miR-195	CLIP-seq
MIRT922628	hsa-miR-198	CLIP-seq
MIRT922629	hsa-miR-2052	CLIP-seq
MIRT922630	hsa-miR-2113	CLIP-seq
MIRT922631	hsa-miR-300	CLIP-seq
MIRT922632	hsa-miR-325	CLIP-seq
MIRT922633	hsa-miR-338-3p	CLIP-seq
MIRT922634	hsa-miR-3685	CLIP-seq
MIRT922635	hsa-miR-381	CLIP-seq
MIRT922636	hsa-miR-384	CLIP-seq
MIRT922637	hsa-miR-424	CLIP-seq
MIRT922638	hsa-miR-4282	CLIP-seq
MIRT922639	hsa-miR-4418	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922641	hsa-miR-4530	CLIP-seq
MIRT922642	hsa-miR-4536	CLIP-seq
MIRT922643	hsa-miR-4666-3p	CLIP-seq
MIRT922644	hsa-miR-4699-5p	CLIP-seq
MIRT922645	hsa-miR-4709-3p	CLIP-seq
MIRT922646	hsa-miR-497	CLIP-seq
MIRT922647	hsa-miR-500a	CLIP-seq
MIRT922648	hsa-miR-509-3-5p	CLIP-seq
MIRT922649	hsa-miR-509-5p	CLIP-seq
MIRT922650	hsa-miR-513a-3p	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT922652	hsa-miR-618	CLIP-seq
MIRT922653	hsa-miR-628-3p	CLIP-seq
MIRT922654	hsa-miR-3658	CLIP-seq
MIRT922655	hsa-miR-4426	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922656	hsa-miR-4647	CLIP-seq
MIRT922657	hsa-miR-4662b	CLIP-seq
MIRT922643	hsa-miR-4666-3p	CLIP-seq
MIRT922658	hsa-miR-485-3p	CLIP-seq
MIRT922659	hsa-miR-487a	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT922660	hsa-miR-590-3p	CLIP-seq
MIRT1973311	hsa-miR-1246	CLIP-seq
MIRT1973312	hsa-miR-1290	CLIP-seq
MIRT922629	hsa-miR-2052	CLIP-seq
MIRT1973313	hsa-miR-3157-5p	CLIP-seq
MIRT1973314	hsa-miR-3167	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT1973315	hsa-miR-4691-3p	CLIP-seq
MIRT1973316	hsa-miR-4802-3p	CLIP-seq
MIRT1973317	hsa-miR-490-5p	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT1973318	hsa-miR-548c-3p	CLIP-seq
MIRT1973319	hsa-miR-876-5p	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT2208918	hsa-miR-548n	CLIP-seq
MIRT2208919	hsa-miR-548t	CLIP-seq
MIRT922631	hsa-miR-300	CLIP-seq
MIRT922635	hsa-miR-381	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922643	hsa-miR-4666-3p	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
GATA1	Repression	22902925
SMAD4	Repression	14525983

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20956529
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	20956529
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	20956529
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	20956529
GO:0001967	Process	Suckling behavior	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	14525983, 16189514, 20956529, 21516116, 25416956, 32296183, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IMP	20956529
GO:0016607	Component	Nuclear speck	IDA
GO:0030336	Process	Negative regulation of cell migration	IDA	20956529
GO:0033262	Process	Regulation of nuclear cell cycle DNA replication	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	21750150
GO:0046545	Process	Development of primary female sexual characteristics	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0060244	Process	Negative regulation of cell proliferation involved in contact inhibition	IEA
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IDA	16980615

MIM	HGNC	e!Ensembl
603803	2663	ENSG00000276644

Q9UI36

Protein name

Dachshund homolog 1 (Dach1)

Protein function

Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of E

PDB

1L8R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02437	Ski_Sno	172 → 281	SKI/SNO/DAC family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen. {ECO:0000269|PubMed:11543628}.

Sequence

MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPI
ASAAAAAATVTSTGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGG
GISAGGGVASSTPINASTGSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVE
NTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITP
VVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKRTQSVTSPE
NSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNN
QHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQ
QSHLLPNGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVE
TSVIKERVPDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMN
QMLMGLSPNVLPGPKEGDLAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQP
LPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLREREL
RETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLR
VLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY

Sequence length

758

Interactions

View interactions

DACH1 (dachshund family transcription factor 1)