Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1602
Gene name Gene Name - the full gene name approved by the HGNC.	Dachshund family transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DACH1
Synonyms (NCBI Gene) Gene synonyms aliases	DACH
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Droso

Show/Hide all(64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018559	hsa-miR-335-5p	Microarray	18185580
MIRT054838	hsa-miR-217	Luciferase reporter assay/Western blot, qRT-PCR	25653720
MIRT734493	hsa-miR-552-3p	ChIP-seq, Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	33867818
MIRT922624	hsa-miR-15a	CLIP-seq
MIRT922625	hsa-miR-15b	CLIP-seq
MIRT922626	hsa-miR-16	CLIP-seq
MIRT922627	hsa-miR-195	CLIP-seq
MIRT922628	hsa-miR-198	CLIP-seq
MIRT922629	hsa-miR-2052	CLIP-seq
MIRT922630	hsa-miR-2113	CLIP-seq
MIRT922631	hsa-miR-300	CLIP-seq
MIRT922632	hsa-miR-325	CLIP-seq
MIRT922633	hsa-miR-338-3p	CLIP-seq
MIRT922634	hsa-miR-3685	CLIP-seq
MIRT922635	hsa-miR-381	CLIP-seq
MIRT922636	hsa-miR-384	CLIP-seq
MIRT922637	hsa-miR-424	CLIP-seq
MIRT922638	hsa-miR-4282	CLIP-seq
MIRT922639	hsa-miR-4418	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922641	hsa-miR-4530	CLIP-seq
MIRT922642	hsa-miR-4536	CLIP-seq
MIRT922643	hsa-miR-4666-3p	CLIP-seq
MIRT922644	hsa-miR-4699-5p	CLIP-seq
MIRT922645	hsa-miR-4709-3p	CLIP-seq
MIRT922646	hsa-miR-497	CLIP-seq
MIRT922647	hsa-miR-500a	CLIP-seq
MIRT922648	hsa-miR-509-3-5p	CLIP-seq
MIRT922649	hsa-miR-509-5p	CLIP-seq
MIRT922650	hsa-miR-513a-3p	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT922652	hsa-miR-618	CLIP-seq
MIRT922653	hsa-miR-628-3p	CLIP-seq
MIRT922654	hsa-miR-3658	CLIP-seq
MIRT922655	hsa-miR-4426	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922656	hsa-miR-4647	CLIP-seq
MIRT922657	hsa-miR-4662b	CLIP-seq
MIRT922643	hsa-miR-4666-3p	CLIP-seq
MIRT922658	hsa-miR-485-3p	CLIP-seq
MIRT922659	hsa-miR-487a	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT922660	hsa-miR-590-3p	CLIP-seq
MIRT1973311	hsa-miR-1246	CLIP-seq
MIRT1973312	hsa-miR-1290	CLIP-seq
MIRT922629	hsa-miR-2052	CLIP-seq
MIRT1973313	hsa-miR-3157-5p	CLIP-seq
MIRT1973314	hsa-miR-3167	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT1973315	hsa-miR-4691-3p	CLIP-seq
MIRT1973316	hsa-miR-4802-3p	CLIP-seq
MIRT1973317	hsa-miR-490-5p	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT1973318	hsa-miR-548c-3p	CLIP-seq
MIRT1973319	hsa-miR-876-5p	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq
MIRT2208918	hsa-miR-548n	CLIP-seq
MIRT2208919	hsa-miR-548t	CLIP-seq
MIRT922631	hsa-miR-300	CLIP-seq
MIRT922635	hsa-miR-381	CLIP-seq
MIRT922640	hsa-miR-4511	CLIP-seq
MIRT922643	hsa-miR-4666-3p	CLIP-seq
MIRT922651	hsa-miR-548b-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
GATA1	Repression	22902925
SMAD4	Repression	14525983

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20956529
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	20956529
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	20956529
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	20956529
GO:0001967	Process	Suckling behavior	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	14525983, 16189514, 20956529, 21516116, 25416956, 32296183, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IMP	20956529
GO:0016607	Component	Nuclear speck	IDA
GO:0030336	Process	Negative regulation of cell migration	IDA	20956529
GO:0033262	Process	Regulation of nuclear cell cycle DNA replication	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	21750150
GO:0046545	Process	Development of primary female sexual characteristics	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0060244	Process	Negative regulation of cell proliferation involved in contact inhibition	IEA
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IDA	16980615

MIM	HGNC	e!Ensembl
603803	2663	ENSG00000276644

Protein

UniProt ID

Q9UI36

Protein name

Dachshund homolog 1 (Dach1)

Protein function

Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of E

PDB

1L8R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02437	Ski_Sno	172 → 281	SKI/SNO/DAC family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen. {ECO:0000269|PubMed:11543628}.

Sequence

MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPI
ASAAAAAATVTSTGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGG
GISAGGGVASSTPINASTGSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVE
NTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITP
VVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKRTQSVTSPE
NSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNN
QHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQ
QSHLLPNGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVE
TSVIKERVPDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMN
QMLMGLSPNVLPGPKEGDLAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQP
LPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLREREL
RETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLR
VLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY

Sequence length

758

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gout	Gout	N/A	N/A	GWAS
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (62)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26683690
Adenocarcinoma of Lung	Inhibit	26810067
Adenocarcinoma of Lung	Associate	31503425
Adenoma	Associate	24472434
Auriculo condylar syndrome	Associate	35879406
Bixler Christian Gorlin syndrome	Inhibit	33313942
Breast Neoplasms	Associate	14525983, 19605405, 24392136, 27993161, 35097124
Breast Neoplasms	Inhibit	23798621, 28659634
Carcinogenesis	Associate	24472434, 28659634
Carcinoma Hepatocellular	Inhibit	25940701
Carcinoma Non Small Cell Lung	Associate	22980976, 30720199
Cardiovascular Diseases	Associate	24465431
Carotid Stenosis	Associate	30335165
Colorectal Neoplasms	Stimulate	24472434
Colorectal Neoplasms	Associate	31450919
Compassion Fatigue	Associate	34390367
Coronary Artery Disease	Associate	24465431
Coronary Disease	Associate	24465431
Developmental Dysplasia of the Hip	Associate	36454308
Diabetes Mellitus	Associate	24465431, 32569224, 36585034, 37766305
Diabetes Mellitus Type 2	Associate	24465431
Diabetic Nephropathies	Associate	32408786
Endometrial Neoplasms	Associate	32569224, 33378353
Esophageal Neoplasms	Associate	36247858
Glomerulonephritis IGA	Inhibit	27888806, 33313942
Hereditary renal agenesis	Associate	23262432
Hereditary Renal Cancer Associated 1	Associate	27888806
Heterochromia iridis	Associate	23840513
Hirschsprung disease 1	Associate	23840513
Inflammation	Associate	32408786
Inflammation	Inhibit	33313942
Insulin Resistance	Associate	24465431
Kidney Diseases	Inhibit	27888806, 33998596
Kidney Diseases Cystic	Associate	23262432
Lung Neoplasms	Associate	26683690, 26810067
Lymphatic Metastasis	Inhibit	30261897
Lymphatic Metastasis	Associate	36247858
Melanoma	Associate	33378353
Microsatellite Instability	Associate	31450919
Neoplasm Metastasis	Inhibit	24392136
Neoplasm Metastasis	Associate	28659634
Neoplasms	Associate	25410484, 25776071, 32569224, 33378353, 36247858, 37766305
Neoplasms	Inhibit	25940701, 26810067, 30261897, 33867818, 35097124
Nephrosis Lipoid	Inhibit	27888806
Oropharyngeal Neoplasms	Associate	25487617
Pancreatic Neoplasms	Associate	33867818, 34389782
Polydactyly	Associate	34022343
Polydactyly Postaxial	Associate	34022343
Precancerous Conditions	Associate	30598579
Prediabetic State	Associate	24465431
Prostatic Intraepithelial Neoplasia	Inhibit	37095257
Prostatic Neoplasms	Inhibit	19351840
Prostatic Neoplasms	Associate	33378353, 37095257
Prostatic Neoplasms Castration Resistant	Inhibit	19351840
Psoriasis	Associate	39344312
Renal Insufficiency	Associate	36585034
Renal Insufficiency Chronic	Associate	20383146, 21980298
Senior Loken Syndrome	Associate	23262432
Spinocerebellar Degenerations	Associate	31450919
Squamous Cell Carcinoma of Head and Neck	Associate	30261897
Stomach Neoplasms	Associate	24589339
Uterine Neoplasms	Associate	33378353

DACH1 (dachshund family transcription factor 1)