Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1602
Gene name Gene Name - the full gene name approved by the HGNC.
Dachshund family transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DACH1
Synonyms (NCBI Gene) Gene synonyms aliases
DACH
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Droso
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018559 hsa-miR-335-5p Microarray 18185580
MIRT054838 hsa-miR-217 Luciferase reporter assay/Western blot, qRT-PCR 25653720
MIRT734493 hsa-miR-552-3p ChIP-seq, Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting 33867818
MIRT922624 hsa-miR-15a CLIP-seq
MIRT922625 hsa-miR-15b CLIP-seq
Transcription factors
Transcription factor Regulation Reference
GATA1 Repression 22902925
SMAD4 Repression 14525983
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 20956529
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 20956529
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 20956529
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603803 2663 ENSG00000276644
Protein
UniProt ID Q9UI36
Protein name Dachshund homolog 1 (Dach1)
Protein function Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of E
PDB 1L8R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02437 Ski_Sno 172 281 SKI/SNO/DAC family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen. {ECO:0000269|PubMed:11543628}.
Sequence
MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPI
ASAAAAAATVTSTGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGG
GISAGGGVASSTPINASTGSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVE
NTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITP
VVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTN
ASSRPGRPPKRTQSVTSPE
NSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNN
QHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQ
QSHLLPNGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVE
TSVIKERVPDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMN
QMLMGLSPNVLPGPKEGDLAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQP
LPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLREREL
RETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLR
VLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY
Sequence length 758
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Kidney Disease Chronic kidney disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 26683690
Adenocarcinoma of Lung Inhibit 26810067
Adenocarcinoma of Lung Associate 31503425
Adenoma Associate 24472434
Auriculo condylar syndrome Associate 35879406
Bixler Christian Gorlin syndrome Inhibit 33313942
Breast Neoplasms Associate 14525983, 19605405, 24392136, 27993161, 35097124
Breast Neoplasms Inhibit 23798621, 28659634
Carcinogenesis Associate 24472434, 28659634
Carcinoma Hepatocellular Inhibit 25940701