DEUP1 (deuterosome assembly protein 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID 159989
Gene name Deuterosome assembly protein 1
Gene symbol DEUP1
Synonyms (NCBI Gene)
CCDC67
Chromosome 11
Chromosome location 11q21
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all (14)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 29892012, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005814 Component Centriole IBA
GO:0007099 Process Centriole replication IBA
GO:0030030 Process Cell projection organization IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617148 26344 ENSG00000165325
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q05D60
Protein name Deuterosome assembly protein 1 (Coiled-coil domain-containing protein 67)
Protein function Key structural component of the deuterosome, a structure that promotes de novo centriole amplification in multiciliated cells. Deuterosome-mediated centriole amplification occurs in terminally differentiated multiciliated cells and can generate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17045 CEP63 11 → 280 Centrosomal protein of 63 kDa Coiled-coil
Sequence 
MENQAHNTMGTSPCEAELQELMEQIDIMVSNKKMDWERKMRALETRLDLRDQELANAQTC
LDQKGQEVGLLRQKLDSLEKCNLAMTQNYEGQLQSLKAQFSKLTNNFEKLRLHQMKQNKV
PRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQTHLISLDAQQKLLSEKCNQ
FQKQAQSYQTQLNGKKQCLEDSSSEIPRLICDPDPNCEINERDEFIIEKLKSAVNEIALS
RNKLQDENQKLLQELKMYQRQCQAMEAGLSEVKSELQSRDDLLRIIEMERLQLHRELLKI
GECQNAQGNKTRLESSYLPSIKEPERKIKELFSVMQDQPNHEKELNKIRSQLQQVEEYHN
SEQERMRNEISDLTEELHQKEITIATVTKKAALLEKQLKMELEIKEKMLAKQKVSDMKYK
AVRTENTHLKGMMGDLDPGEYMSMDFTNREQSRHTSINKLQYENERLRNDLAKLHVNGKS
TWTNQNTYEETGRYAYQSQIKVEQNEERLSHDCEPNRSTMPPLPPSTFQAKEMTSPLVSD
DDVFPLSPPDMSFPASLAAQHFLLEEEKRAKELEKLLNTHIDELQRHTEFTLNKYSKLKQ
NRHI
Sequence length 604
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Polycystic kidney disease Uncertain significance rs779898555 RCV001175196
Show/Hide Text Mining Associations (11)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Ciliopathies Associate 32055034
Death Associate 25238935
Inflammation Associate 28355295
Lymphatic Metastasis Inhibit 26716505
Neoplasm Metastasis Associate 25238935
Neoplasms Inhibit 26716505
Precancerous Conditions Stimulate 31081096
Prostatic Neoplasms Associate 25238935, 34417538
Thyroid Cancer Papillary Inhibit 26716505
Thyroid Cancer Papillary Associate 31081096