CYP26A1 (cytochrome P450 family 26 subfamily A member 1)

Gene

• Entrez ID: 1592
• Gene name: Cytochrome P450 family 26 subfamily A member 1
• Gene symbol: CYP26A1
• Synonyms (NCBI Gene): CP26, CYP26, P450RAI, P450RAI1
• Chromosome: 10
• Chromosome location: 10q23.33
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic r

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018549	hsa-miR-335-5p	Microarray	18185580
MIRT021786	hsa-miR-132-3p	Microarray	17612493
MIRT921060	hsa-miR-1299	CLIP-seq
MIRT921061	hsa-miR-875-3p	CLIP-seq
MIRT2512399	hsa-miR-1229	CLIP-seq
MIRT2512400	hsa-miR-3143	CLIP-seq
MIRT2512401	hsa-miR-342-3p	CLIP-seq
MIRT2512402	hsa-miR-4263	CLIP-seq
MIRT2512403	hsa-miR-4659a-3p	CLIP-seq
MIRT2512404	hsa-miR-4659b-3p	CLIP-seq
MIRT2512405	hsa-miR-4803	CLIP-seq
MIRT2512406	hsa-miR-518a-5p	CLIP-seq
MIRT2512407	hsa-miR-527	CLIP-seq
MIRT2512408	hsa-miR-570	CLIP-seq
MIRT2512409	hsa-miR-576-5p	CLIP-seq
MIRT2512410	hsa-miR-942	CLIP-seq
MIRT2512399	hsa-miR-1229	CLIP-seq
MIRT2678963	hsa-miR-1256	CLIP-seq
MIRT2512400	hsa-miR-3143	CLIP-seq
MIRT2512401	hsa-miR-342-3p	CLIP-seq
MIRT2512402	hsa-miR-4263	CLIP-seq
MIRT2512403	hsa-miR-4659a-3p	CLIP-seq
MIRT2512404	hsa-miR-4659b-3p	CLIP-seq
MIRT2678964	hsa-miR-4668-3p	CLIP-seq
MIRT2512405	hsa-miR-4803	CLIP-seq
MIRT2512406	hsa-miR-518a-5p	CLIP-seq
MIRT2512407	hsa-miR-527	CLIP-seq
MIRT2512408	hsa-miR-570	CLIP-seq
MIRT2512409	hsa-miR-576-5p	CLIP-seq
MIRT2512410	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0001972	Function	Retinoic acid binding	IDA	10823918
GO:0004497	Function	Monooxygenase activity	IBA
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006766	Process	Vitamin metabolic process	TAS
GO:0006805	Process	Xenobiotic metabolic process	IDA	26937021
GO:0007417	Process	Central nervous system development	IBA
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IDA	9228017, 9716180, 10823918
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IEA
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016709	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IDA	26937021
GO:0019825	Function	Oxygen binding	TAS	9228017
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	NAS	9228017
GO:0032526	Process	Response to retinoic acid	IEA
GO:0033189	Process	Response to vitamin A	IEA
GO:0034653	Process	Retinoic acid catabolic process	IBA
GO:0034653	Process	Retinoic acid catabolic process	IDA	10823918
GO:0034653	Process	Retinoic acid catabolic process	IEA
GO:0042573	Process	Retinoic acid metabolic process	IDA	9716180, 22020119
GO:0046872	Function	Metal ion binding	IEA
GO:0048387	Process	Negative regulation of retinoic acid receptor signaling pathway	TAS	14532297
GO:0062182	Function	All-trans retinoic acid 4-hydrolase activity	IEA
GO:0062183	Function	All-trans retinoic acid 18-hydroxylase activity	IDA	22020119
GO:0062183	Function	All-trans retinoic acid 18-hydroxylase activity	IEA

Other IDs

• MIM: 602239
• HGNC: 2603
• e!Ensembl: ENSG00000095596

Protein

• UniProt ID: O43174
• Protein name: Cytochrome P450 26A1 (CYP26A1) (EC 1.14.13.-) (Cytochrome P450 retinoic acid-inactivating 1) (Cytochrome P450RAI) (hP450RAI) (Retinoic acid 4-hydroxylase) (Retinoic acid-metabolizing cytochrome)
• Protein function: A cytochrome P450 monooxygenase involved in the metabolism of retinoates (RAs), the active metabolites of vitamin A, and critical signaling molecules in animals (PubMed:22020119, PubMed:9228017, PubMed:9716180). RAs exist as at least four differ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	45 → 487	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in most fetal and adult tissues with highest levels in adult liver, heart, pituitary gland, adrenal gland, placenta and regions of the brain (PubMed:9826557). Expressed at high levels in lung, pancreas, skin and uterus (at pr
• Sequence:

  MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
  VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
  GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
  VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
  NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
  GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
  KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
  LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
  YPVDNLPARFTHFHGEI

• Sequence length: 497

Pathways

KEGG:

Retinol metabolism
Metabolic pathways

Reactome:

Vitamins
RA biosynthesis pathway