Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1591
Gene name	Cytochrome P450 family 24 subfamily A member 1
Gene symbol	CYP24A1
Synonyms (NCBI Gene)	CP24CYP24HCAIHCINF1P450-CC24
Chromosome	20
Chromosome location	20q13.2
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial

Show/Hide all (13)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6068812	A>G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs35051736	C>G,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs35873579	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant, synonymous variant
rs114368325	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs139763321	A>G	Pathogenic	Coding sequence variant, missense variant
rs387907322	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs387907323	C>A	Pathogenic	Coding sequence variant, stop gained
rs387907324	C>T	Pathogenic	Coding sequence variant, missense variant
rs774432244	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs777676129	CTT>-	Uncertain-significance, pathogenic	Coding sequence variant, inframe deletion
rs777947329	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, stop gained
rs781367354	C>A,T	Likely-pathogenic	Missense variant, initiator codon variant
rs876657376	AG>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant

192

Show/Hide all (192)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004408	hsa-miR-125b-5p	qRT-PCRLuciferase reporter assayWestern blotNorthern blot	19570947
MIRT004408	hsa-miR-125b-5p	Review	20026422
MIRT004408	hsa-miR-125b-5p	Reporter assay	19570947
MIRT024646	hsa-miR-215-5p	Microarray	19074876
MIRT026473	hsa-miR-192-5p	Microarray	19074876
MIRT029534	hsa-miR-26b-5p	Microarray	19088304
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT638072	hsa-miR-636	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT638071	hsa-miR-3977	HITS-CLIP	23824327
MIRT638070	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT638072	hsa-miR-636	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT638071	hsa-miR-3977	HITS-CLIP	23824327
MIRT638070	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT633075	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT633074	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT633073	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT633072	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT630104	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT614643	hsa-miR-8485	HITS-CLIP	23824327
MIRT614642	hsa-miR-4643	HITS-CLIP	23824327
MIRT614641	hsa-miR-4666b	HITS-CLIP	23824327
MIRT755562	miR-21	qRT-PCR	35807864
MIRT921010	hsa-miR-1207-5p	CLIP-seq
MIRT921011	hsa-miR-125a-3p	CLIP-seq
MIRT921012	hsa-miR-1827	CLIP-seq
MIRT921013	hsa-miR-218	CLIP-seq
MIRT921014	hsa-miR-2682	CLIP-seq
MIRT921015	hsa-miR-2861	CLIP-seq
MIRT921016	hsa-miR-30a	CLIP-seq
MIRT921017	hsa-miR-30b	CLIP-seq
MIRT921018	hsa-miR-30c	CLIP-seq
MIRT921019	hsa-miR-30d	CLIP-seq
MIRT921020	hsa-miR-30e	CLIP-seq
MIRT921021	hsa-miR-3189-5p	CLIP-seq
MIRT921022	hsa-miR-3616-5p	CLIP-seq
MIRT921023	hsa-miR-3647-5p	CLIP-seq
MIRT921024	hsa-miR-365	CLIP-seq
MIRT921025	hsa-miR-3907	CLIP-seq
MIRT921026	hsa-miR-3909	CLIP-seq
MIRT921027	hsa-miR-3918	CLIP-seq
MIRT921028	hsa-miR-3974	CLIP-seq
MIRT921029	hsa-miR-4477b	CLIP-seq
MIRT921030	hsa-miR-449c	CLIP-seq
MIRT921031	hsa-miR-4512	CLIP-seq
MIRT921032	hsa-miR-4536	CLIP-seq
MIRT921033	hsa-miR-4652-3p	CLIP-seq
MIRT921034	hsa-miR-4729	CLIP-seq
MIRT921035	hsa-miR-4731-3p	CLIP-seq
MIRT921036	hsa-miR-4758-3p	CLIP-seq
MIRT921037	hsa-miR-4763-3p	CLIP-seq
MIRT921038	hsa-miR-4795-5p	CLIP-seq
MIRT921039	hsa-miR-4801	CLIP-seq
MIRT921040	hsa-miR-495	CLIP-seq
MIRT921041	hsa-miR-501-3p	CLIP-seq
MIRT921042	hsa-miR-502-3p	CLIP-seq
MIRT921043	hsa-miR-552	CLIP-seq
MIRT921044	hsa-miR-553	CLIP-seq
MIRT921045	hsa-miR-573	CLIP-seq
MIRT921046	hsa-miR-586	CLIP-seq
MIRT921047	hsa-miR-590-3p	CLIP-seq
MIRT921048	hsa-miR-628-5p	CLIP-seq
MIRT921049	hsa-miR-642b	CLIP-seq
MIRT921050	hsa-miR-940	CLIP-seq
MIRT921051	hsa-miR-1202	CLIP-seq
MIRT921010	hsa-miR-1207-5p	CLIP-seq
MIRT921052	hsa-miR-204	CLIP-seq
MIRT921053	hsa-miR-211	CLIP-seq
MIRT921014	hsa-miR-2682	CLIP-seq
MIRT921015	hsa-miR-2861	CLIP-seq
MIRT921021	hsa-miR-3189-5p	CLIP-seq
MIRT921054	hsa-miR-3194-5p	CLIP-seq
MIRT921055	hsa-miR-34b	CLIP-seq
MIRT921056	hsa-miR-34c-3p	CLIP-seq
MIRT921024	hsa-miR-365	CLIP-seq
MIRT921026	hsa-miR-3909	CLIP-seq
MIRT921027	hsa-miR-3918	CLIP-seq
MIRT921057	hsa-miR-3972	CLIP-seq
MIRT921028	hsa-miR-3974	CLIP-seq
MIRT921058	hsa-miR-4287	CLIP-seq
MIRT921029	hsa-miR-4477b	CLIP-seq
MIRT921030	hsa-miR-449c	CLIP-seq
MIRT921031	hsa-miR-4512	CLIP-seq
MIRT921032	hsa-miR-4536	CLIP-seq
MIRT921059	hsa-miR-4685-3p	CLIP-seq
MIRT921036	hsa-miR-4758-3p	CLIP-seq
MIRT921037	hsa-miR-4763-3p	CLIP-seq
MIRT921040	hsa-miR-495	CLIP-seq
MIRT921044	hsa-miR-553	CLIP-seq
MIRT921047	hsa-miR-590-3p	CLIP-seq
MIRT921050	hsa-miR-940	CLIP-seq
MIRT921010	hsa-miR-1207-5p	CLIP-seq
MIRT1972904	hsa-miR-199a-3p	CLIP-seq
MIRT1972905	hsa-miR-199b-3p	CLIP-seq
MIRT921014	hsa-miR-2682	CLIP-seq
MIRT921015	hsa-miR-2861	CLIP-seq
MIRT1972906	hsa-miR-3129-5p	CLIP-seq
MIRT921027	hsa-miR-3918	CLIP-seq
MIRT921030	hsa-miR-449c	CLIP-seq
MIRT921031	hsa-miR-4512	CLIP-seq
MIRT921032	hsa-miR-4536	CLIP-seq
MIRT921037	hsa-miR-4763-3p	CLIP-seq
MIRT921044	hsa-miR-553	CLIP-seq
MIRT921050	hsa-miR-940	CLIP-seq
MIRT2208540	hsa-miR-4789-3p	CLIP-seq
MIRT2208541	hsa-miR-602	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
VDR	Activation	23463632
VDR	Repression	9687155
VDR	Unknown	19244278;19429444;21763285

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEP	17023519
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006066	Process	Alcohol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006766	Process	Vitamin metabolic process	TAS
GO:0008403	Function	25-hydroxycholecalciferol-24-hydroxylase activity	IBA
GO:0008403	Function	25-hydroxycholecalciferol-24-hydroxylase activity	IDA	8679605, 24893882
GO:0008403	Function	25-hydroxycholecalciferol-24-hydroxylase activity	IEA
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	TAS	8506296
GO:0030342	Function	1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity	IBA
GO:0030342	Function	1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity	IDA	8506296, 8679605, 16617161, 24893882
GO:0030342	Function	1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity	IEA
GO:0030342	Function	1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity	TAS
GO:0030343	Function	Vitamin D3 25-hydroxylase activity	IDA	25727742
GO:0030343	Function	Vitamin D3 25-hydroxylase activity	IEA
GO:0033280	Process	Response to vitamin D	IBA
GO:0033280	Process	Response to vitamin D	IDA	16720713
GO:0036378	Process	Calcitriol biosynthetic process from calciol	IEA
GO:0042359	Process	Vitamin D metabolic process	IEA
GO:0042359	Process	Vitamin D metabolic process	IEA
GO:0042359	Process	Vitamin D metabolic process	TAS
GO:0042369	Process	Vitamin D catabolic process	IBA
GO:0042369	Process	Vitamin D catabolic process	IDA	8506296, 8679605, 16617161, 24893882, 29461981
GO:0042369	Process	Vitamin D catabolic process	IEA
GO:0042369	Process	Vitamin D catabolic process	NAS	16720713
GO:0044283	Process	Small molecule biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0062180	Function	25-hydroxycholecalciferol-23-hydroxylase activity	IDA	8679605, 11012668, 24893882
GO:0062180	Function	25-hydroxycholecalciferol-23-hydroxylase activity	IEA
GO:0062181	Function	1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activity	IDA	16617161, 24893882, 29461981
GO:0062181	Function	1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activity	IEA
GO:0070561	Process	Vitamin D receptor signaling pathway	NAS	16720713
GO:0070576	Function	Vitamin D 24-hydroxylase activity	IEA
GO:0071305	Process	Cellular response to vitamin D	IEA

MIM	HGNC	e!Ensembl
126065	2602	ENSG00000019186

Q07973

Protein name

1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial (24-OHase) (Vitamin D(3) 24-hydroxylase) (EC 1.14.15.16) (Cytochrome P450 24A1) (Cytochrome P450-CC24)

Protein function

A cytochrome P450 monooxygenase with a key role in vitamin D catabolism and calcium homeostasis. Via C24- and C23-oxidation pathways, catalyzes the inactivation of both the vitamin D precursor calcidiol (25-hydroxyvitamin D(3)) and the active ho

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	58 → 512	Cytochrome P450	Domain

Sequence

MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPG
PTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYR
TESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKIN
EVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIM
AIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSAD
FLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVL
PENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIV
RKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR

Sequence length

514

Interactions

View interactions

	KEGG		Reactome
	Steroid biosynthesis Metabolic pathways Parathyroid hormone synthesis, secretion and action MicroRNAs in cancer		Vitamin D (calciferol) metabolism Vitamins Defective CYP24A1 causes Hypercalcemia, infantile (HCAI)

204

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CYP24A1-related disorder	Likely pathogenic; Pathogenic	rs777011420, rs2516345389, rs6068812, rs139763321	RCV004756331 RCV003393239 RCV003894819 RCV004756031
Hypercalcemia, infantile, 1	Pathogenic; Likely pathogenic	rs770055617, rs988715134, rs2146489987, rs777011420, rs2516403268, rs1299109745, rs777947329, rs774967736, rs762334108, rs751526033, rs2516404261, rs2092633467, rs2516376283, rs2516405173, rs876657376 View all (11 more)	RCV005419288 RCV001780349 RCV001780908 RCV003992590 RCV002510418 RCV004594653 RCV000190576 RCV003237305 RCV003237314 RCV005030202 RCV004546871 RCV004555334 RCV004555481 RCV004555488 RCV000022526 RCV000033205 RCV000022527 RCV000033209 RCV000022528 RCV000033210 RCV000033211 RCV000778636 RCV000779350 RCV000856569 RCV005029768 RCV001280863
Muscle spasm	Likely pathogenic; Pathogenic	rs114368325	RCV000414890
Renal tubulopathies	Likely pathogenic; Pathogenic	rs1170841548	RCV006250227

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Likely benign	rs36106327	RCV005914794
Colorectal cancer	Benign; Likely benign	rs566481776	RCV005907142
Infantile hypercalcemia	Uncertain significance; Benign; Likely benign	rs147124541, rs886056784, rs10623012, rs372687331, rs4811494, rs73913757	RCV000337120 RCV000375214 RCV000264272 RCV000293863 RCV000271140 RCV000302888
Lung cancer	Likely benign	rs36106327	RCV005914797
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	rs35051736	RCV005901901
Thymoma	Likely benign	rs36106327	RCV005914795
Thyroid cancer, nonmedullary, 1	Likely benign	rs36106327	RCV005914796

Show/Hide Text Mining Associations (106)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Associate	38195505
Adenocarcinoma	Associate	19901270, 24736069, 25090635
Adenocarcinoma of Lung	Associate	21169243, 24736069, 32165494, 32998690, 34323652, 35664356
Adenoma	Stimulate	22511602
Adenoma	Associate	26241700
Adenomyosis	Associate	38195505
Arthritis Rheumatoid	Associate	34925313
Asthma	Associate	16600026, 19852851, 21613960, 36839181
Bone Diseases	Associate	22337913
Breast Neoplasms	Associate	14760115, 15863722, 16280049, 19667160, 20440542, 22480149, 22649517, 23393347, 25421379, 25736056, 31548577, 34003583
Breast Neoplasms	Stimulate	24416388
Calcinosis	Associate	33219692
Calcium Metabolism Disorders	Associate	25165186
Carcinogenesis	Associate	19901270, 23423976, 23674869, 28821819
Carcinoma Basal Cell	Associate	15077124, 34003583
Carcinoma Hepatocellular	Associate	20345479
Carcinoma Non Small Cell Lung	Associate	25544771, 27669215, 34836039
Carcinoma Non Small Cell Lung	Inhibit	27669215
Carcinoma Pancreatic Ductal	Associate	25090635
Carcinoma Squamous Cell	Associate	28211524
Cardiovascular Diseases	Associate	33219692
Cerebral Infarction	Associate	31872978
Chronic Kidney Disease Mineral and Bone Disorder	Associate	33211721
Colitis Ulcerative	Associate	28811712
Colonic Polyps	Associate	28811712
Colorectal Neoplasms	Associate	19706847, 21084270, 22940288, 23423976, 23463632, 23674869, 24562971, 28009432, 28665452, 28811712, 28821819, 31963716, 34191826, 37414755
Colorectal Neoplasms	Stimulate	37750623
Coronary Disease	Associate	32762692
COVID 19	Associate	36833234
Dermatitis Atopic	Associate	26315479
Diabetes Mellitus Type 1	Associate	32764491
Diabetes Mellitus Type 2	Associate	29358755, 32542627
Disease	Associate	25165186
Drug Hypersensitivity	Associate	26489816
Endometrial Neoplasms	Associate	24732451, 27769055
Esophageal Neoplasms	Associate	14760115
Essential Hypertension	Associate	31102703
Fetal Death	Associate	34662328
Gastrointestinal Hemorrhage	Associate	35114859
Hemolytic Uremic Syndrome	Inhibit	23965431
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16886688
HIV Infections	Associate	23877860
Hypercalcemia	Associate	11909970, 22112808, 22337913, 25375986, 26097993, 27105398, 28324001, 28470390, 28874334, 31288237, 33856702, 34662328, 34721296, 35282483, 36625425, 37358380 View all (1 more)
Hypercalcemia Infantile	Associate	22112808, 28304097, 28324001, 28470390, 28874334, 33864587, 34125233, 34217267, 34721296, 35282483, 36625425, 40428323
Hypercalciuria	Associate	22337913, 23293122, 28324001, 28470390, 31288237, 34125233, 34721296, 35282483, 36625425
Hyperostosis corticalis deformans juvenilis	Associate	10703924
Hypertension	Associate	31872978, 31918428
Hypertension Pregnancy Induced	Associate	35684156
Hypophosphatemia	Associate	34721296
Ige Responsiveness Atopic	Associate	19852851
Immunologic Deficiency Syndromes	Inhibit	27105398
Immunologic Deficiency Syndromes	Associate	27105398
Inflammation	Associate	24416388
Intestinal Atresia	Associate	24367646
Kidney Calculi	Associate	23293122, 31288237, 36625425, 40372791, 40759569
Kidney Diseases	Associate	34721296
Kidney Failure Chronic	Associate	27605961, 33099630
Laryngeal Neoplasms	Associate	38567579
Leukemia	Associate	35563410
Lithiasis	Associate	34721296
Lung Neoplasms	Associate	22386975, 22797725, 25415319, 25519225, 29726119, 31264381
Lung Neoplasms	Stimulate	32165494
Lupus Erythematosus Systemic	Associate	27283331
Lymphatic Metastasis	Inhibit	22511602
Lymphoma	Associate	35563410
Lymphoma Large B Cell Diffuse	Associate	31638226
Lymphoma Non Hodgkin	Associate	22544453
Melanoma	Associate	17172823, 22576141, 25334067, 30200275, 31235702, 39456696
Metabolism Inborn Errors	Inhibit	34662328
Multiple Sclerosis	Associate	25526461, 34163021, 34855907, 36823318
Necrosis	Associate	25334067
Neoplasm Metastasis	Associate	22511602
Neoplasms	Associate	16886688, 17591932, 20304059, 20831823, 21169243, 21725204, 22386975, 23463632, 23674869, 24416388, 24732451, 24736069, 25334067, 25544771, 26241700 View all (8 more)
Neoplasms	Stimulate	25090635
Nephrocalcinosis	Associate	23293122, 27105398, 31288237, 34721296, 35282483, 36625425
Nephrolithiasis	Associate	22337913, 23293122, 25375986, 27105398, 31288237, 35282483
Nevus Pigmented	Associate	25334067
Pancreatic Neoplasms	Associate	23826131, 25799011
Pancreatic Neoplasms	Stimulate	23826131
Pancreatitis	Associate	27105398
Pediatric Obesity	Associate	28874334
Premature Ejaculation	Associate	36226342
Prostate Cancer Hereditary 7	Inhibit	23377224
Prostatic Diseases	Inhibit	20587525
Prostatic Neoplasms	Associate	19667147, 20687218
Prostatic Neoplasms	Inhibit	20587525
Prostatitis	Associate	12899539, 21725204
Renal Insufficiency Chronic	Associate	30286109, 35282483
Sick Sinus Syndrome	Stimulate	31638226
Skin Neoplasms	Associate	28211524
Small Cell Lung Carcinoma	Associate	25415319
Spinal Muscular Atrophies of Childhood	Associate	19706847
Stroke	Associate	31872978
Thyroid Cancer Papillary	Inhibit	22511602
Thyroid Cancer Papillary	Associate	22690899
Thyroid Carcinoma Anaplastic	Associate	22511602
Thyroid Neoplasms	Associate	20860424, 22690899
Thyroid Neoplasms	Stimulate	22511602
Urologic Diseases	Associate	31235702
Uveal melanoma	Associate	31235702
Uveomeningoencephalitic Syndrome	Associate	27716192
Vascular Calcification	Associate	33219692
Ventricular Fibrillation	Associate	30142216
Vitamin D Deficiency	Associate	23877860, 27283331, 27669215, 28470390, 29358755, 30286109, 34662328, 35684156
Vitamin D Hydroxylation Deficient Rickets Type 1A	Associate	23293122
Williams Syndrome	Associate	33856702

CYP24A1 (cytochrome P450 family 24 subfamily A member 1)