Gene Gene information from NCBI Gene database.
Entrez ID 158866
Gene name ZDHHC palmitoyltransferase 15
Gene symbol ZDHHC15
Synonyms (NCBI Gene)
DHHC15MRX91
Chromosome X
Chromosome location Xq13.3
Summary The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found
miRNA miRNA information provided by mirtarbase database.
300
miRTarBase ID miRNA Experiments Reference
MIRT017787 hsa-miR-335-5p Microarray 18185580
MIRT019337 hsa-miR-148b-3p Microarray 17612493
MIRT645556 hsa-miR-3177-5p HITS-CLIP 23313552
MIRT645555 hsa-miR-6867-5p HITS-CLIP 23313552
MIRT645554 hsa-miR-4666a-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005794 Component Golgi apparatus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300576 20342 ENSG00000102383
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96MV8
Protein name Palmitoyltransferase ZDHHC15 (EC 2.3.1.225) (Acyltransferase ZDHHC15) (EC 2.3.1.-) (Zinc finger DHHC domain-containing protein 15) (DHHC-15)
Protein function Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates (PubMed:18817523, PubMed:23034182). Has no stringent fatty acid selectivity and in addition to palmitate can also transfer onto target proteins myrista
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01529 DHHC 125 249 DHHC palmitoyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, liver, lung, kidney, heart and brain. {ECO:0000269|PubMed:15915161}.
Sequence
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIL
YHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVY
TRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY
SVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSR
NKTTLEAFC
TPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSM
NESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
Sequence length 337
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
9
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Spastic diplegia Likely pathogenic rs1042821596 RCV001281349
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign; Likely benign rs751518520 RCV005867148
Intellectual disability, X-linked 91 Uncertain significance rs2083746861 RCV001335428
Malignant tumor of esophagus Benign; Likely benign rs751518520 RCV005867147
Oculocutaneous albinism type 1B Uncertain significance rs748654597 RCV003228192
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Amenorrhea Associate 25747126
Glioma Associate 37161425
Intellectual Disability Associate 23871722