LINGO2 (leucine rich repeat and Ig domain containing 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
158038
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat and Ig domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LINGO2
Synonyms (NCBI Gene) Gene synonyms aliases
LERN3, LRRN6C
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p21.2-p21.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(20)
miRTarBase ID miRNA Experiments Reference
MIRT721925 hsa-miR-5193 HITS-CLIP 19536157
MIRT721924 hsa-miR-660-3p HITS-CLIP 19536157
MIRT721923 hsa-miR-370-3p HITS-CLIP 19536157
MIRT721922 hsa-miR-6893-3p HITS-CLIP 19536157
MIRT721921 hsa-miR-1976 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 33961781
GO:0005886 Component Plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0038023 Function Signaling receptor activity IBA
GO:0051965 Process Positive regulation of synapse assembly IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609793 21207 ENSG00000174482
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7L985
Protein name Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 (Leucine-rich repeat neuronal protein 3) (Leucine-rich repeat neuronal protein 6C)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 57 → 117 Leucine rich repeat Repeat
PF13855 LRR_8 81 → 141 Leucine rich repeat Repeat
PF13855 LRR_8 105 → 165 Leucine rich repeat Repeat
PF13855 LRR_8 129 → 189 Leucine rich repeat Repeat
PF13855 LRR_8 249 → 309 Leucine rich repeat Repeat
PF13855 LRR_8 297 → 357 Leucine rich repeat Repeat
PF07679 I-set 410 → 500 Immunoglobulin I-set domain Domain
Sequence 
MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETK
ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLV
PLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE
QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDM
MPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQ
ELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD
CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGM
YVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT
ILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRR
FNMKMI
Sequence length 606
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (11)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Type 2 diabetes (PheCode 250.2) N/A N/A GWAS
Hypertension Hypertension (confirmatory factor analysis Factor 12) N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (15)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 27445529
Autistic Disorder Associate 28973307
Birk Barel Mental Retardation Dysmorphism Syndrome Associate 33316910
Breast Neoplasms Associate 37559094
Carcinoma Renal Cell Associate 25239644
Cell Transformation Neoplastic Associate 19190341
Essential Tremor Associate 20369371
Mesothelioma Malignant Associate 23830731
Neoplasms Inhibit 23830731
Neoplasms Associate 30696080