LINGO2 (leucine rich repeat and Ig domain containing 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 158038
Gene name Leucine rich repeat and Ig domain containing 2
Gene symbol LINGO2
Synonyms (NCBI Gene)
LERN3LRRN6C
Chromosome 9
Chromosome location 9p21.2-p21.1
miRNA miRNA information provided by mirtarbase database.
20
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (20)
miRTarBase ID miRNA Experiments Reference
MIRT721925 hsa-miR-5193 HITS-CLIP 19536157
MIRT721924 hsa-miR-660-3p HITS-CLIP 19536157
MIRT721923 hsa-miR-370-3p HITS-CLIP 19536157
MIRT721922 hsa-miR-6893-3p HITS-CLIP 19536157
MIRT721921 hsa-miR-1976 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 33961781
GO:0005886 Component Plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0038023 Function Signaling receptor activity IBA
GO:0051965 Process Positive regulation of synapse assembly IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609793 21207 ENSG00000174482
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7L985
Protein name Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 (Leucine-rich repeat neuronal protein 3) (Leucine-rich repeat neuronal protein 6C)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 57 → 117 Leucine rich repeat Repeat
PF13855 LRR_8 81 → 141 Leucine rich repeat Repeat
PF13855 LRR_8 105 → 165 Leucine rich repeat Repeat
PF13855 LRR_8 129 → 189 Leucine rich repeat Repeat
PF13855 LRR_8 249 → 309 Leucine rich repeat Repeat
PF13855 LRR_8 297 → 357 Leucine rich repeat Repeat
PF07679 I-set 410 → 500 Immunoglobulin I-set domain Domain
Sequence 
MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETK
ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLV
PLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE
QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDM
MPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQ
ELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD
CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGM
YVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT
ILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRR
FNMKMI
Sequence length 606
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Likely benign rs113646467 RCV005927597
Show/Hide Text Mining Associations (15)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 27445529
Autistic Disorder Associate 28973307
Birk Barel Mental Retardation Dysmorphism Syndrome Associate 33316910
Breast Neoplasms Associate 37559094
Carcinoma Renal Cell Associate 25239644
Cell Transformation Neoplastic Associate 19190341
Essential Tremor Associate 20369371
Mesothelioma Malignant Associate 23830731
Neoplasms Inhibit 23830731
Neoplasms Associate 30696080