SBSPON (somatomedin B and thrombospondin type 1 domain containing)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways
Entrez ID 157869
Gene name Somatomedin B and thrombospondin type 1 domain containing
Gene symbol SBSPON
Synonyms (NCBI Gene)
C8orf84RPESP
Chromosome 8
Chromosome location 8q21.11
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Gene Gene ontology Other IDs Protein Pathways
Show/Hide all (4)
GO ID Ontology Definition Evidence Reference
GO:0005201 Function Extracellular matrix structural constituent RCA 20551380, 25037231, 27068509, 27559042
GO:0005576 Component Extracellular region IEA
GO:0031012 Component Extracellular matrix HDA 20551380
GO:0031012 Component Extracellular matrix HDA 25037231, 27068509, 27559042
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
621005 30362 ENSG00000164764
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IVN8
Protein name Somatomedin-B and thrombospondin type-1 domain-containing protein (RPE-spondin)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF19028 TSP1_spondin 75 → 125 Spondin-like TSP1 domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in aorta extracellular matrix (at protein level). {ECO:0000269|PubMed:20551380}.
Sequence 
MRTLWMALCALSRLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTG
DCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAG
CLEYSTPQGQDCGHTYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPH
CALENWPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Sequence length 264
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways
  Reactome
    Defective B3GALTL causes Peters-plus syndrome (PpS)
O-glycosylation of TSR domain-containing proteins