Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
157753
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 74
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM74
Synonyms (NCBI Gene) Gene synonyms aliases
NET36
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q23.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023244 hsa-miR-122-5p Microarray 17612493
MIRT1439088 hsa-miR-570 CLIP-seq
MIRT1439089 hsa-miR-607 CLIP-seq
MIRT2131503 hsa-miR-376c CLIP-seq
MIRT2131504 hsa-miR-4789-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000421 Component Autophagosome membrane IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613935 26409 ENSG00000164841
Protein
UniProt ID Q96NL1
Protein name Transmembrane protein 74
Protein function Plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14927 Neurensin 142 269 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, lung, and placenta. {ECO:0000269|PubMed:18294959}.
Sequence
MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKL
SSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINL
EQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFIS
AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESARLGAHLDRCVIAGLCLLT
LGGVILSCLLMMSMWKGELYRRNRFASSK
ESAKLYGSFNFRMKTSTNENTLELSLVEEDA
LAVQS
Sequence length 305
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Myoclonic Epilepsy Juvenile myoclonic epilepsy N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35029906
Breast Neoplasms Associate 40644891
Carcinoma Hepatocellular Associate 34746309
Neoplasms Associate 29048433
Neurodegenerative Diseases Associate 33236465