Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	157724
Gene name	Solute carrier family 7 member 13
Gene symbol	SLC7A13
Synonyms (NCBI Gene)	AGT-1AGT1XAT2
Chromosome	8
Chromosome location	8q21.3

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018744	hsa-miR-335-5p	Microarray	18185580
MIRT1367122	hsa-miR-3606	CLIP-seq
MIRT1367123	hsa-miR-3908	CLIP-seq
MIRT1367124	hsa-miR-3942-5p	CLIP-seq
MIRT1367125	hsa-miR-4325	CLIP-seq
MIRT1367126	hsa-miR-4522	CLIP-seq
MIRT1367127	hsa-miR-4703-5p	CLIP-seq
MIRT1367128	hsa-miR-4714-5p	CLIP-seq
MIRT1367129	hsa-miR-4766-3p	CLIP-seq
MIRT1367130	hsa-miR-4786-3p	CLIP-seq
MIRT1367131	hsa-miR-507	CLIP-seq
MIRT1367132	hsa-miR-557	CLIP-seq
MIRT1367133	hsa-miR-921	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence
GO:0003333	Process	Amino acid transmembrane transport	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006865	Process	Amino acid transport	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IBA
GO:0015297	Function	Antiporter activity	IEA
GO:0015810	Process	Aspartate transmembrane transport	IEA
GO:0015811	Process	L-cystine transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IEA

MIM	HGNC	e!Ensembl
617256	23092	ENSG00000164893

Q8TCU3

Protein name

Solute carrier family 7 member 13 (Sodium-independent aspartate/glutamate transporter 1) (X-amino acid transporter 2)

Protein function

Associates with SLC3A1/rBAT to form a functional heterodimeric complex that transports anionic and neutral amino acids across the apical plasma membrane of renal epithelium. Preferentially mediates exchange transport, but can also operate via fa

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13520	AA_permease_2	15 → 439	Amino acid permease	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the kidney. {ECO:0000269|PubMed:11943479}.

Sequence

MDRGEKIQLKRVFGYWWGTSFLLINIIGAGIFVSPKGVLAYSCMNVGVSLCVWAGCAILA
MTSTLCSAEISISFPCSGAQYYFLKRYFGSTVAFLNLWTSLFLGSGVVAGQALLLAEYSI
QPFFPSCSVPKLPKKCLALAMLWIVGILTSRGVKEVTWLQIASSVLKVSILSFISLTGVV
FLIRGKKENVERFQNAFDAELPDISHLIQAIFQGYFAYSGGACFTLIAGELKKPRTTIPK
CIFTALPLVTVVYLLVNISYLTVLTPREILSSDAVAITWADRAFPSLAWIMPFAISTSLF
SNLLISIFKSSRPIYLASQEGQLPLLFNTLNSHSSPFTAVLLLVTLGSLAIILTSLIDLI
NYIFFTGSLWSILLMIGILRRRYQEPNLSIPYKVFLSFPLATIVIDVGLVVIPLVKSPNV
HYVYVLLLVLSGLLFYIPLIHFKIRLAWFEKMTCYLQLLFNICLPDVSEE

Sequence length

470

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Coronary Artery Disease	Associate	21437271	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Associate	34469896	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC7A13 (solute carrier family 7 member 13)