Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1577
Gene name	Cytochrome P450 family 3 subfamily A member 5
Gene symbol	CYP3A5
Synonyms (NCBI Gene)	CP35CYPIIIA5P450PCN3PCN3
Chromosome	7
Chromosome location	7q22.1
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protei

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017425	hsa-miR-335-5p	Microarray	18185580
MIRT718062	hsa-miR-4438	HITS-CLIP	19536157
MIRT718061	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT718060	hsa-miR-2115-5p	HITS-CLIP	19536157
MIRT718059	hsa-miR-516a-3p	HITS-CLIP	19536157
MIRT718058	hsa-miR-516b-3p	HITS-CLIP	19536157
MIRT718057	hsa-miR-7162-5p	HITS-CLIP	19536157
MIRT718056	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT718055	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT718054	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT718053	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT449882	hsa-miR-3690	PAR-CLIP	22100165
MIRT449881	hsa-miR-4254	PAR-CLIP	22100165
MIRT449880	hsa-miR-504-3p	PAR-CLIP	22100165
MIRT449879	hsa-miR-122-5p	PAR-CLIP	22100165
MIRT449878	hsa-miR-3161	PAR-CLIP	22100165
MIRT449877	hsa-miR-599	PAR-CLIP	22100165
MIRT735100	hsa-miR-500a-5p	Luciferase reporter assayWestern blottingqRT-PCR	31955224
MIRT718062	hsa-miR-4438	HITS-CLIP	19536157
MIRT718061	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT718060	hsa-miR-2115-5p	HITS-CLIP	19536157
MIRT718059	hsa-miR-516a-3p	HITS-CLIP	19536157
MIRT718058	hsa-miR-516b-3p	HITS-CLIP	19536157
MIRT718057	hsa-miR-7162-5p	HITS-CLIP	19536157
MIRT718056	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT718055	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT718054	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT718053	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT449882	hsa-miR-3690	PAR-CLIP	22100165
MIRT449881	hsa-miR-4254	PAR-CLIP	22100165
MIRT449880	hsa-miR-504-3p	PAR-CLIP	22100165
MIRT449879	hsa-miR-122-5p	PAR-CLIP	22100165
MIRT449878	hsa-miR-3161	PAR-CLIP	22100165
MIRT449877	hsa-miR-599	PAR-CLIP	22100165
MIRT1547821	hsa-miR-128	CLIP-seq
MIRT1547822	hsa-miR-140-3p	CLIP-seq
MIRT1547823	hsa-miR-197	CLIP-seq
MIRT1547824	hsa-miR-28-3p	CLIP-seq
MIRT1547825	hsa-miR-4302	CLIP-seq
MIRT1547821	hsa-miR-128	CLIP-seq
MIRT1547822	hsa-miR-140-3p	CLIP-seq
MIRT1547823	hsa-miR-197	CLIP-seq
MIRT1547824	hsa-miR-28-3p	CLIP-seq
MIRT1547825	hsa-miR-4302	CLIP-seq
MIRT2447925	hsa-miR-3908	CLIP-seq
MIRT2447926	hsa-miR-410	CLIP-seq
MIRT2447927	hsa-miR-618	CLIP-seq
MIRT2512491	hsa-miR-338-5p	CLIP-seq
MIRT2512492	hsa-miR-4633-5p	CLIP-seq
MIRT2512493	hsa-miR-4694-5p	CLIP-seq
MIRT2512494	hsa-miR-4698	CLIP-seq
MIRT2512495	hsa-miR-522	CLIP-seq
MIRT2512496	hsa-miR-532-5p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
SP1	Unknown	11485307
SP3	Unknown	11485307
VDR	Unknown	22939842
YY1	Unknown	22292071

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002933	Process	Lipid hydroxylation	IDA	14559847
GO:0002933	Process	Lipid hydroxylation	IEA
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	ISS
GO:0004497	Function	Monooxygenase activity	TAS	2732228
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IBA
GO:0008202	Process	Steroid metabolic process	IDA	14559847
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008202	Process	Steroid metabolic process	TAS	2732228
GO:0008210	Process	Estrogen metabolic process	IDA	12865317
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IDA	11093772
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IEA
GO:0009822	Process	Alkaloid catabolic process	IDA	15039299
GO:0009822	Process	Alkaloid catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IDA	15039299
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019825	Function	Oxygen binding	IEA
GO:0019825	Function	Oxygen binding	TAS	2732228
GO:0020037	Function	Heme binding	IEA
GO:0042178	Process	Xenobiotic catabolic process	IDA	15039299
GO:0042178	Process	Xenobiotic catabolic process	IEA
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042573	Process	Retinoic acid metabolic process	IDA	11093772
GO:0042573	Process	Retinoic acid metabolic process	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	TAS	2732228
GO:0046222	Process	Aflatoxin metabolic process	IEA
GO:0046222	Process	Aflatoxin metabolic process	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IBA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IEA
GO:0070989	Process	Oxidative demethylation	IBA
GO:0070989	Process	Oxidative demethylation	IDA	15039299
GO:0070989	Process	Oxidative demethylation	IEA
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IBA
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IDA	14559847
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IEA
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA

MIM	HGNC	e!Ensembl
605325	2638	ENSG00000106258

P20815

Protein name

Cytochrome P450 3A5 (EC 1.14.14.1) (CYPIIIA5) (Cytochrome P450-PCN3)

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins (PubMed:10681376, PubMed:11093772, PubMed:12865317, PubMed:2732228). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, a

PDB

5VEU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	38 → 492	Cytochrome P450	Domain

Sequence

MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE

Sequence length

502

Interactions

View interactions

	KEGG		Reactome
	Steroid hormone biosynthesis Retinol metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Metabolic pathways Chemical carcinogenesis - DNA adducts		Xenobiotics Aflatoxin activation and detoxification

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Likely benign	rs28371764	RCV005935159
Cervical cancer	Likely benign	rs28371764	RCV005935162
Cholangiocarcinoma	Likely benign	rs28371764	RCV005935167
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Likely benign	rs28371764	RCV005935169
CYP3A5-related disorder	Uncertain significance; Likely benign; Benign	rs1811815021, rs28383469, rs41279857, rs111960361, rs41303343, rs115267978, rs754237133, rs10264272, rs200628208, rs28365095, rs772471367, rs28371764	RCV003392855 RCV003919212 RCV003906985 RCV003907006 RCV003919760 RCV003939598 RCV003949574 RCV003914459 RCV003926906 RCV003932007 RCV003957208 RCV003976497
Essential hypertension	not provided	rs765108001	RCV000709780
Familial pancreatic carcinoma	Benign; Likely benign	rs776746, rs28371764	RCV005893895 RCV005935163
Gastric cancer	Benign	rs776746	RCV005893897
Hypertension, salt-sensitive essential, susceptibility to	association; drug response; risk factor	rs776746	RCV000005370
Lung cancer	Benign	rs776746	RCV005893898
Malignant lymphoma, large B-cell, diffuse	Likely benign	rs28371764	RCV005935164
Malignant tumor of esophagus	Benign; Likely benign	rs776746, rs28371764	RCV005893892 RCV005935160
Nonpapillary renal cell carcinoma	Benign; Likely benign	rs776746, rs28371764	RCV005893893 RCV005935161
Ovarian cancer	Benign	rs776746	RCV005893894
Ovarian serous cystadenocarcinoma	Likely benign	rs28371764	RCV005935166
refractory myasthenia gravis	association; drug response; risk factor	rs776746	RCV002227926
Sarcoma	Benign; Likely benign	rs776746, rs28371764	RCV005893896 RCV005935165
Tacrolimus response	association; drug response; risk factor	rs776746	RCV002292440
Uterine corpus endometrial carcinoma	Likely benign	rs28371764	RCV005935168

Show/Hide Text Mining Associations (84)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	27217047
Adenocarcinoma of Lung	Associate	28381170
Adenoma	Stimulate	16281975
Anxiety	Inhibit	34523245
Arthritis Rheumatoid	Associate	28324194
Blood Platelet Disorders	Associate	16754899, 26961113
Breast Neoplasms	Associate	22938436, 23143606, 32351149, 32456253
Calcinosis Cutis	Inhibit	22971343
Carcinoma Hepatocellular	Associate	12822676, 25024626, 27203676, 35099304
Carcinoma Non Small Cell Lung	Inhibit	32350633
Carcinoma Pancreatic Ductal	Associate	37920921
Carcinoma Squamous Cell	Stimulate	17373732
Cardiotoxicity	Associate	28440407, 38547766
Cardiovascular Diseases	Associate	39459499
Carotid Stenosis	Associate	37247449
Colitis Ulcerative	Associate	32570960, 33886687
Colorectal Neoplasms	Associate	17615053, 25934339
Corticosteroid Binding Globulin Deficiency	Associate	36139147
Depressive Disorder	Associate	34435592
Depressive Disorder	Inhibit	34523245
Diabetes Mellitus	Associate	21206424, 29621269
Diabetes Mellitus Type 2	Associate	29439084
Diabetes Mellitus Type 2	Inhibit	36734157
Diarrhea	Associate	31770256
Drug Overdose	Associate	35110472
Drug Related Side Effects and Adverse Reactions	Associate	17264302, 28440407, 30320358, 35135554
Drug Resistant Epilepsy	Associate	35338956
Embolic Stroke	Associate	37247449
Epilepsy	Associate	32029960
Esophageal Squamous Cell Carcinoma	Associate	17373732, 23358850
Gastrointestinal Diseases	Associate	17264302
Glomerulonephritis Membranous	Associate	31770256
Glucocorticoid Receptor Deficiency	Associate	36139147
Graft vs Host Disease	Associate	26325438
Heart Failure	Associate	31652395
Hemorrhage	Associate	39459499
Hepatolenticular Degeneration	Associate	34117631
HIV Infections	Associate	26892777
Hypercholesterolemia	Associate	35839255
Hyperglycemia	Associate	25966085
Hypertension	Associate	12754175, 15492926, 18248681, 21851254, 25966085, 28448186, 33633318, 36897672, 36982571
Hypoxia	Inhibit	30320358
Infections	Associate	17264302
Inflammation	Associate	36139147, 40613206
Intestinal Neoplasms	Associate	31773688
Iron Overload	Associate	31652395
Kidney Diseases	Associate	25966085, 33633318
Kidney Failure Chronic	Associate	26773964
Leukemia Lymphocytic Chronic B Cell	Associate	28440407, 40613206
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21039054, 23394475
Leukemia Myeloid Acute	Associate	25992585, 28440407
Leukopenia	Associate	21702053
Liver Failure Acute	Associate	24104197
Lung Neoplasms	Associate	12822676, 1336722, 24085358, 32350633
Lupus Erythematosus Systemic	Associate	28324194
Medulloblastoma	Associate	30320358
Multiple Myeloma	Associate	36581339
Muscular Diseases	Associate	30595243
Muscular Dystrophy Duchenne	Associate	29232479
Myocardial Ischemia	Associate	26626639
Neoplasms	Associate	16281975, 24699256, 25526449, 38448381
Neoplasms Squamous Cell	Associate	32350633
Nephrotic Syndrome	Associate	29615122, 29637588
Neurotoxicity Syndromes	Associate	21225912, 21702053, 25966085
Neutropenia	Associate	21702053, 23143606
Non alcoholic Fatty Liver Disease	Associate	20485142
Obesity	Associate	22299599, 35110472
Peripheral Nervous System Diseases	Associate	12846892, 21225912
Pneumocystis Infections	Associate	25966085
Porphyria Acute Intermittent	Associate	30808393
Pre Eclampsia	Associate	15492926
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	21225912, 28440407, 36952646
Prostatic Neoplasms	Associate	21493872, 34570813, 36688864, 37924098
Proteinuria	Associate	35879888
Protoporphyria Erythropoietic	Associate	36952646
Renal Insufficiency Chronic	Associate	26800425, 37522799
Respiratory Distress Syndrome	Associate	22445700
Sarcoma Ewing	Associate	25670065
Squamous Cell Carcinoma of Head and Neck	Inhibit	18254958
Squamous Cell Carcinoma of Head and Neck	Associate	31322243
Stroke	Associate	37247449
Taste Disorders	Associate	15492926
Uterine Cervical Neoplasms	Associate	12822676
Weight Loss	Associate	20485142

CYP3A5 (cytochrome P450 family 3 subfamily A member 5)