Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1573
Gene name	Cytochrome P450 family 2 subfamily J member 2
Gene symbol	CYP2J2
Synonyms (NCBI Gene)	CPJ2CYPIIJ2
Chromosome	1
Chromosome location	1p32.1
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006875	hsa-let-7b-5p	Luciferase reporter assayqRT-PCRWestern blot	22761738
MIRT921365	hsa-miR-140-5p	CLIP-seq
MIRT921366	hsa-miR-3942-3p	CLIP-seq
MIRT1972992	hsa-miR-224	CLIP-seq
MIRT1972993	hsa-miR-3166	CLIP-seq
MIRT1972994	hsa-miR-3200-5p	CLIP-seq
MIRT1972995	hsa-miR-4303	CLIP-seq
MIRT1972996	hsa-miR-4468	CLIP-seq
MIRT1972997	hsa-miR-494	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
JUN	Unknown	12737630;16008525

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006082	Process	Organic acid metabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	TAS
GO:0006690	Process	Icosanoid metabolic process	IDA	19737933
GO:0006690	Process	Icosanoid metabolic process	TAS	8631948
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	TAS	11901223
GO:0008016	Process	Regulation of heart contraction	TAS	8631948
GO:0008392	Function	Arachidonate epoxygenase activity	IDA	8631948, 11901223
GO:0008392	Function	Arachidonate epoxygenase activity	TAS
GO:0008404	Function	Arachidonate 14,15-epoxygenase activity	IDA	11901223
GO:0008405	Function	Arachidonate 11,12-epoxygenase activity	IDA	11901223
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0016853	Function	Isomerase activity	IDA	19737933
GO:0016853	Function	Isomerase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019373	Process	Epoxygenase P450 pathway	IDA	8631948, 11901223
GO:0019373	Process	Epoxygenase P450 pathway	TAS
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043651	Process	Linoleic acid metabolic process	IDA	11901223
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0071614	Function	Linoleic acid epoxygenase activity	IDA	11901223
GO:0106255	Function	Hydroperoxy icosatetraenoate isomerase activity	IEA
GO:0106301	Function	Arachidonate 5,6-epoxygenase activity	IEA

MIM	HGNC	e!Ensembl
601258	2634	ENSG00000134716

P51589

Protein name

Cytochrome P450 2J2 (EC 1.14.14.-) (Albendazole monooxygenase (hydroxylating)) (EC 1.14.14.74) (Albendazole monooxygenase (sulfoxide-forming)) (EC 1.14.14.73) (Arachidonic acid epoxygenase) (CYPIIJ2) (Hydroperoxy icosatetraenoate isomerase) (EC 5.4.4.7)

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of polyunsaturated fatty acids (PUFA) in the cardiovascular system (PubMed:19965576, PubMed:8631948). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	44 → 498	Cytochrome P450	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, present at lower levels in liver, kidney and skeletal muscle (at protein level). {ECO:0000269|PubMed:8631948}.

Sequence

MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV

Sequence length

502

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Linoleic acid metabolism Metabolic pathways Serotonergic synapse Inflammatory mediator regulation of TRP channels Ovarian steroidogenesis Lipid and atherosclerosis		Fatty acids Xenobiotics Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Pulmonary disease, chronic obstructive, susceptibility to	association	rs11572191	RCV002508824

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	25406731
Carcinoma Hepatocellular	Inhibit	12737630
Carcinoma Hepatocellular	Associate	33312341
Carcinoma Pancreatic Ductal	Associate	34707002
Carcinoma Renal Cell	Associate	34258261, 35308176
Cardiomyopathies	Inhibit	32210298
Cardiovascular Diseases	Associate	19105833, 32210298
Carnevale syndrome	Associate	19105833
Cerebral Infarction	Associate	18216721
Conversion Disorder	Associate	34371182
Coronary Artery Disease	Associate	15466638, 19105833, 23684773, 31000184
Coronary Disease	Associate	17429317, 24148690
Crohn Disease	Associate	24058654
Diabetes Gestational	Associate	37370090
Disease	Associate	32210298
Drug Related Side Effects and Adverse Reactions	Associate	21846841
Essential Hypertension	Associate	18219097
Heart Failure	Associate	32210298
Hypertension	Associate	18219097
Hypertensive Retinopathy	Associate	34666595
Hypoxia	Inhibit	12737630
Hypoxia	Associate	34666595
Hypoxia Brain	Inhibit	12737630
Inflammation	Associate	24058654, 34258261
Macular Degeneration	Associate	31132075
Metabolic Syndrome	Associate	36518097
Myocardial Infarction	Associate	19105833
Neoplasms	Associate	19550113, 21846841, 24819355
Neoplasms	Stimulate	25406731
Pulmonary Disease Chronic Obstructive	Inhibit	29850024
Renal Insufficiency Chronic	Associate	18769365
Retinopathy of Prematurity	Stimulate	34666595
Ventricular Remodeling	Associate	32210298
Wounds and Injuries	Associate	32210298

CYP2J2 (cytochrome P450 family 2 subfamily J member 2)