Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	156
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled receptor kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GRK2
Synonyms (NCBI Gene) Gene synonyms aliases	ADRBK1, BARK1, BETA-ARK1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal

Show/Hide all(47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT459273	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT459272	hsa-miR-575	PAR-CLIP	23592263
MIRT459271	hsa-miR-9500	PAR-CLIP	23592263
MIRT459270	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT459269	hsa-miR-4270	PAR-CLIP	23592263
MIRT459268	hsa-miR-4441	PAR-CLIP	23592263
MIRT459267	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT459266	hsa-miR-5190	PAR-CLIP	23592263
MIRT459265	hsa-miR-6733-3p	PAR-CLIP	23592263
MIRT459264	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT459263	hsa-miR-642a-3p	PAR-CLIP	23592263
MIRT459262	hsa-miR-642b-3p	PAR-CLIP	23592263
MIRT459261	hsa-miR-1827	PAR-CLIP	23592263
MIRT459260	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT459259	hsa-miR-3612	PAR-CLIP	23592263
MIRT459258	hsa-miR-650	PAR-CLIP	23592263
MIRT459257	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT459256	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT459255	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT459254	hsa-miR-4443	PAR-CLIP	23592263
MIRT459253	hsa-miR-548ac	PAR-CLIP	23592263
MIRT459252	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT459251	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT459250	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT459249	hsa-miR-548z	PAR-CLIP	23592263
MIRT459248	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT459247	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT459246	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT459245	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT459244	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT459243	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT459242	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT459241	hsa-miR-3912-3p	PAR-CLIP	23592263
MIRT459239	hsa-miR-3163	PAR-CLIP	23592263
MIRT459240	hsa-miR-4742-5p	PAR-CLIP	23592263
MIRT182151	hsa-miR-4269	PAR-CLIP	23592263
MIRT182153	hsa-miR-6715b-5p	PAR-CLIP	23592263
MIRT459238	hsa-miR-4514	PAR-CLIP	23592263
MIRT459237	hsa-miR-4692	PAR-CLIP	23592263
MIRT182147	hsa-miR-153-5p	PAR-CLIP	23592263
MIRT182149	hsa-miR-767-5p	PAR-CLIP	23592263
MIRT182148	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT459236	hsa-miR-340-5p	PAR-CLIP	23592263
MIRT182137	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT182138	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT182139	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT182142	hsa-miR-181d-5p	HITS-CLIP	22473208

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SP1	Activation	12423667

Show/Hide all(58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0002026	Process	Regulation of the force of heart contraction	IBA
GO:0002026	Process	Regulation of the force of heart contraction	IEA
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IBA
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IDA	21799898
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IEA
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IMP	15102938
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	ISS
GO:0003108	Process	Negative regulation of the force of heart contraction by chemical signal	IMP	15051637
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	21983013
GO:0004672	Function	Protein kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004703	Function	G protein-coupled receptor kinase activity	IBA
GO:0004703	Function	G protein-coupled receptor kinase activity	IDA	21799898
GO:0004703	Function	G protein-coupled receptor kinase activity	IEA
GO:0004703	Function	G protein-coupled receptor kinase activity	IMP	15102938
GO:0004703	Function	G protein-coupled receptor kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	17006543, 17986524, 18369319, 19008357, 19306925, 19502428, 22447027, 23455922, 28514442, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	17986524
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	21983013
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	ISS
GO:0007217	Process	Tachykinin receptor signaling pathway	IDA	17986524
GO:0007507	Process	Heart development	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019079	Process	Viral genome replication	IMP	23029581
GO:0031623	Process	Receptor internalization	IDA	20074556
GO:0031623	Process	Receptor internalization	IEA
GO:0031694	Function	Alpha-2A adrenergic receptor binding	ISS
GO:0031755	Function	Edg-2 lysophosphatidic acid receptor binding	IDA	19306925
GO:0032473	Component	Cytoplasmic side of mitochondrial outer membrane	IDA	21983013
GO:0033605	Process	Positive regulation of catecholamine secretion	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0045988	Process	Negative regulation of striated muscle contraction	IMP	15051637
GO:0046718	Process	Symbiont entry into host cell	IMP	23029581
GO:0047696	Function	Beta-adrenergic receptor kinase activity	IEA
GO:0047696	Function	Beta-adrenergic receptor kinase activity	TAS
GO:0060048	Process	Cardiac muscle contraction	IMP	15051637
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1901081	Process	Negative regulation of relaxation of smooth muscle	IEA
GO:1901081	Process	Negative regulation of relaxation of smooth muscle	IMP	30284927

MIM	HGNC	e!Ensembl
109635	289	ENSG00000173020

Protein

UniProt ID

P25098

Protein name

Beta-adrenergic receptor kinase 1 (Beta-ARK-1) (EC 2.7.11.15) (G-protein coupled receptor kinase 2)

Protein function

Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them (PubMed:19715378). Key regulator of LPAR1 signaling (PubMed:19306925). Competes with RALA for

PDB

1BAK , 3CIK , 3KRW , 3KRX , 3V5W , 4MK0 , 4PNK , 5HE1 , 5UKK , 5UKL , 5UUU , 5UVC , 5WG3 , 5WG4 , 5WG5 , 6C2Y , 6U7C , 7K7L , 7K7Z , 7PWD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	54 → 174	Regulator of G protein signaling domain	Domain
PF00069	Pkinase	191 → 453	Protein kinase domain	Domain
PF00169	PH	559 → 652	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in peripheral blood leukocytes. {ECO:0000269|PubMed:10085131}.

Sequence

MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL

Sequence length

689

Interactions

View interactions

	KEGG		Reactome
	Chemokine signaling pathway Endocytosis Hedgehog signaling pathway Glutamatergic synapse Olfactory transduction Morphine addiction		Calmodulin induced events G alpha (q) signalling events G alpha (s) signalling events Activation of SMO Cargo recognition for clathrin-mediated endocytosis

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Jeune Syndrome	Jeune syndrome	N/A	N/A	GenCC

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Inhibit	34164834
Arthritis Gouty	Associate	39511617
Arthritis Infectious	Associate	16849637
Arthritis Rheumatoid	Associate	24738138, 36969166
Bacterial Infections	Associate	24465168
Bipolar Disorder	Associate	19400979
Breast Neoplasms	Associate	25279970
Cardiomyopathies	Associate	22685168
Cardiovascular Diseases	Associate	29905975
Depressive Disorder	Stimulate	18805158
Ectrodactyly cardiopathy dysmorphism	Associate	22685168
Fibrosis	Stimulate	31953139
Glioblastoma	Associate	33806345
Heart Diseases	Associate	30104167
Heart Failure	Stimulate	16678578, 20443948
Heart Failure	Associate	19487588, 20202864, 22685168, 29905975, 30104167
Heart Failure	Inhibit	21357420
Hypertension	Associate	19487588, 20443852, 27555048
Inflammation	Associate	24738138, 39511617
Jeune syndrome	Associate	33200460
Lymphoma T Cell	Associate	30018141
Malaria	Associate	22745844
Multiple Sclerosis	Associate	24738138
Neoplasms	Associate	36233192
Pancreatic Neoplasms	Associate	25849100
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	24738138
Prostatic Neoplasms	Associate	12869546, 17146477
Prostatitis	Associate	12869546, 17146477
Pulmonary Valve Insufficiency	Associate	30104167
Severe Acute Respiratory Syndrome	Associate	31953139
Stroke	Associate	21127457
Takotsubo Cardiomyopathy	Stimulate	30143703
Venous Thromboembolism	Associate	26397997
Ventricular Remodeling	Associate	21357420

GRK2 (G protein-coupled receptor kinase 2)