Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1559
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome P450 family 2 subfamily C member 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYP2C9
Synonyms (NCBI Gene) Gene synonyms aliases	CPC9, CYP2C, CYP2C10, CYPIIC9, P450-2C9, P450IIC9
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q23.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

Show/Hide all(10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057910	A>C,G	Other, drug-response	Coding sequence variant, missense variant
rs1799853	C>T	Other, drug-response, likely-benign	Coding sequence variant, missense variant
rs4917639	A>C,T	Drug-response	Intron variant
rs7089580	A>G,T	Drug-response	Intron variant
rs7900194	G>A,C,T	Drug-response	Missense variant, coding sequence variant
rs9332131	A>-	Other, drug-response	Frameshift variant, coding sequence variant
rs28371685	C>T	Drug-response, likely-benign	Missense variant, coding sequence variant
rs28371686	C>A,G	Drug-response, other	Missense variant, coding sequence variant
rs56165452	T>A,C	Drug-response	Missense variant, coding sequence variant
rs72558191	T>G	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT732402	hsa-miR-128-3p	EMSA, Luciferase reporter assay, qRT-PCR, Western blot	25704921
MIRT732402	hsa-miR-128-3p	EMSA, Luciferase reporter assay, qRT-PCR, Western blot	25704921
MIRT732402	hsa-miR-128-3p	EMSA, Luciferase reporter assay, qRT-PCR, Western blot	25704921
MIRT732406	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	25802328
MIRT732406	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	25802328

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
HNF4A	Activation	15919766;16540586;18552123;20086032
HNF4A	Unknown	16882880
NCOA6	Unknown	21292004
NR1I2	Unknown	16749864;18096673;21292004
NR1I3	Unknown	15919766;16749864
PPARA	Repression	20178979
PPARGC1A	Unknown	16882880

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IDA	15766564, 19651758
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	NAS	2827463
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006721	Process	Terpenoid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	19219744, 19651758
GO:0006805	Process	Xenobiotic metabolic process	IMP	21127708
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008202	Process	Steroid metabolic process	IMP	18356043
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IDA	12865317
GO:0008392	Function	Arachidonate epoxygenase activity	IDA	7574697
GO:0008395	Function	Steroid hydroxylase activity	IMP	18356043
GO:0008404	Function	Arachidonate 14,15-epoxygenase activity	IEA
GO:0008405	Function	Arachidonate 11,12-epoxygenase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016098	Process	Monoterpenoid metabolic process	IDA	16401082
GO:0016491	Function	Oxidoreductase activity	IDA	16401082, 19219744
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0018675	Function	(S)-limonene 6-monooxygenase activity	IEA
GO:0018676	Function	(S)-limonene 7-monooxygenase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019373	Process	Epoxygenase P450 pathway	IBA
GO:0019373	Process	Epoxygenase P450 pathway	IDA	7574697
GO:0019373	Process	Epoxygenase P450 pathway	TAS
GO:0019627	Process	Urea metabolic process	IDA	19029318
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0032787	Process	Monocarboxylic acid metabolic process	IDA	19651758
GO:0032787	Process	Monocarboxylic acid metabolic process	IEA
GO:0034875	Function	Caffeine oxidase activity	IDA	18619574
GO:0042178	Process	Xenobiotic catabolic process	IBA
GO:0042178	Process	Xenobiotic catabolic process	IDA	18619574
GO:0042178	Process	Xenobiotic catabolic process	IMP	18356043
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	9618440
GO:0043231	Component	Intracellular membrane-bounded organelle	TAS	2827463, 3032244
GO:0046456	Process	Icosanoid biosynthetic process	IDA	15766564
GO:0046872	Function	Metal ion binding	IEA
GO:0052741	Function	(R)-limonene 6-monooxygenase activity	IEA
GO:0070989	Process	Oxidative demethylation	IDA	18619574
GO:0090346	Process	Organofluorine metabolic process	IDA	19448135
GO:0097267	Process	Omega-hydroxylase P450 pathway	TAS
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA

MIM	HGNC	e!Ensembl
601130	2623	ENSG00000138109

Protein

UniProt ID

P11712

Protein name

Cytochrome P450 2C9 (EC 1.14.14.1) ((R)-limonene 6-monooxygenase) (EC 1.14.14.53) ((S)-limonene 6-monooxygenase) (EC 1.14.14.51) ((S)-limonene 7-monooxygenase) (EC 1.14.14.52) (CYPIIC9) (Cholesterol 25-hydroxylase) (Cytochrome P-450MP) (Cytochrome P450 MP

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids and steroids (PubMed:12865317, PubMed:15766564, PubMed:19965576, PubMed:21576599, PubMed:7574697, PubMed:9435160, PubMed:9866708).

PDB

1OG2 , 1OG5 , 1R9O , 4NZ2 , 5A5I , 5A5J , 5K7K , 5W0C , 5X23 , 5X24 , 5XXI , 6VLT , 7RL2 , 8VX0 , 8VZ7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	30 → 487	Cytochrome P450	Domain

Sequence

MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV

Sequence length

490

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Linoleic acid metabolism Retinol metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Metabolic pathways Serotonergic synapse Chemical carcinogenesis - DNA adducts Lipid and atherosclerosis		Xenobiotics CYP2E1 reactions Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) Biosynthesis of maresin-like SPMs

CYP2C9 (cytochrome P450 family 2 subfamily C member 9)