Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1558
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome P450 family 2 subfamily C member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYP2C8
Synonyms (NCBI Gene) Gene synonyms aliases	CPC8, CYP2C8DM, CYPIIC8, MP-12/MP-20
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q23.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs10509681	T>C	Drug-response, benign	Missense variant, coding sequence variant
rs72558196	T>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006955	hsa-miR-103a-3p	qRT-PCR, Western blot	22723340
MIRT006956	hsa-miR-107	qRT-PCR, Western blot	22723340
MIRT921351	hsa-miR-1	CLIP-seq
MIRT921352	hsa-miR-1257	CLIP-seq
MIRT921353	hsa-miR-206	CLIP-seq
MIRT921354	hsa-miR-3161	CLIP-seq
MIRT921355	hsa-miR-4461	CLIP-seq
MIRT921356	hsa-miR-4658	CLIP-seq
MIRT921357	hsa-miR-4699-5p	CLIP-seq
MIRT921358	hsa-miR-4727-3p	CLIP-seq
MIRT921359	hsa-miR-4747-5p	CLIP-seq
MIRT921360	hsa-miR-4758-5p	CLIP-seq
MIRT921361	hsa-miR-4765	CLIP-seq
MIRT921362	hsa-miR-4790-3p	CLIP-seq
MIRT921363	hsa-miR-613	CLIP-seq
MIRT921364	hsa-miR-633	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
HNF4A	Activation	20086032
NR1I2	Unknown	18096673

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002933	Process	Lipid hydroxylation	IDA	14559847
GO:0004497	Function	Monooxygenase activity	IDA	15766564, 19651758
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006082	Process	Organic acid metabolic process	IDA	19651758
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006721	Process	Terpenoid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	19651758
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IDA	14559847
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IDA	12865317, 14559847
GO:0008392	Function	Arachidonate epoxygenase activity	IDA	7574697
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IDA	11093772
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019373	Process	Epoxygenase P450 pathway	IBA
GO:0019373	Process	Epoxygenase P450 pathway	IDA	7574697
GO:0019373	Process	Epoxygenase P450 pathway	TAS
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0032787	Process	Monocarboxylic acid metabolic process	IEA
GO:0034875	Function	Caffeine oxidase activity	IDA	18619574
GO:0042178	Process	Xenobiotic catabolic process	IBA
GO:0042178	Process	Xenobiotic catabolic process	IDA	18619574
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042573	Process	Retinoic acid metabolic process	IDA	11093772
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0046456	Process	Icosanoid biosynthetic process	IDA	15766564
GO:0046872	Function	Metal ion binding	IEA
GO:0070989	Process	Oxidative demethylation	IDA	18619574
GO:0097267	Process	Omega-hydroxylase P450 pathway	TAS
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IDA	14559847
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IEA

MIM	HGNC	e!Ensembl
601129	2622	ENSG00000138115

Protein

UniProt ID

P10632

Protein name

Cytochrome P450 2C8 (EC 1.14.14.1) (CYPIIC8) (Cytochrome P450 IIC2) (Cytochrome P450 MP-12) (Cytochrome P450 MP-20) (Cytochrome P450 form 1) (S-mephenytoin 4-hydroxylase)

Protein function

A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins (PubMed:11093772, PubMed:14559847, PubMed:15766564, PubMed:19965576, PubMed:7574697). Mechanistical

PDB

1PQ2 , 2NNH , 2NNI , 2NNJ , 2VN0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	30 → 487	Cytochrome P450	Domain

Sequence

MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV

Sequence length

490

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Linoleic acid metabolism Retinol metabolism Drug metabolism - cytochrome P450 Metabolic pathways Serotonergic synapse Chemical carcinogenesis - DNA adducts Lipid and atherosclerosis		Xenobiotics CYP2E1 reactions Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) Biosynthesis of maresin-like SPMs

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Chronic Obstructive Pulmonary Disease	Pulmonary disease, chronic obstructive, susceptibility to	N/A	N/A	ClinVar
Diabetes	Youth-onset type 2 diabetes	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Inhibit	16281975
Anemia	Associate	21107304, 24681964
Anemia Sickle Cell	Associate	25640739
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	18594024, 21685474, 34740282
Breast Neoplasms	Associate	19935798, 21402692, 22527101, 23413280, 25406731
Carcinoma Hepatocellular	Associate	27203676, 29479826, 30148168, 30628708, 30720105, 30971588, 39193514
Carcinoma Hepatocellular	Inhibit	33180658
Carcinoma Pancreatic Ductal	Associate	37920921
Carcinoma Squamous Cell	Stimulate	17373732
Carotid Stenosis	Associate	26686738
Cerebral Infarction	Associate	25947240, 27087514
Chorioamnionitis	Associate	33976432
Colonic Neoplasms	Inhibit	32293332
Coronary Disease	Associate	17429317
Death	Associate	29479826
Diabetes Gestational	Associate	37370090
Diabetes Mellitus Type 2	Associate	19129086
Drug Related Side Effects and Adverse Reactions	Associate	35135554
Esophageal Neoplasms	Associate	32851080
Esophageal Squamous Cell Carcinoma	Associate	17373732
Essential Hypertension	Associate	28513222
Gastrointestinal Neoplasms	Associate	38554324
Gastrointestinal Stromal Tumors	Associate	36178950
Graft vs Host Disease	Associate	36211438
Hepatolenticular Degeneration	Associate	34117631
Inflammation	Associate	17576808
Ischemia	Associate	27087514
Kidney Diseases	Associate	35135554
Leukopenia	Inhibit	24681964
Leukopenia	Associate	24681964
Liver Failure	Associate	36258237
Lown Ganong Levine Syndrome	Associate	19935798
Metabolic Syndrome	Associate	36518097
Multiple Myeloma	Associate	18594024, 21685474
Neoplasm Metastasis	Associate	30148168
Neoplasms	Associate	16281975, 19935798, 27602771, 29479826, 30148168, 40108724
Neoplasms	Stimulate	28971320
Nervous System Diseases	Associate	22527101, 23413280
Neurotoxicity Syndromes	Associate	21702053
Pain	Associate	25640739
Periodontitis	Associate	34740282
Peripheral Nervous System Diseases	Associate	22527101, 24706167, 27736846
Precancerous Conditions	Associate	33180658
Renal Insufficiency	Associate	25640739
Renal Insufficiency Chronic	Associate	18769365
Sick Sinus Syndrome	Inhibit	19935798
Urinary Bladder Neoplasms	Associate	36246885, 40108724
Uterine Cervical Neoplasms	Associate	38376298

CYP2C8 (cytochrome P450 family 2 subfamily C member 8)