AGR3 (anterior gradient 3, protein disulphide isomerase family member)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 155465
Gene name Anterior gradient 3, protein disulphide isomerase family member
Gene symbol AGR3
Synonyms (NCBI Gene)
AG-3AG3BCMP11HAG3PDIA18hAG-3
Chromosome 7
Chromosome location 7p21.1
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically ac
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT019079 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0002162 Function Dystroglycan binding IBA
GO:0002162 Function Dystroglycan binding IDA 12592373
GO:0002162 Function Dystroglycan binding IEA
GO:0005515 Function Protein binding IPI 12592373, 21516116, 25416956, 32296183
GO:0005783 Component Endoplasmic reticulum IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609482 24167 ENSG00000173467
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TD06
Protein name Anterior gradient protein 3 (AG-3) (AG3) (hAG-3) (Anterior gradient 3 homolog) (Breast cancer membrane protein 11) (Protein disulfide isomerase family A, member 18)
Protein function Required for calcium-mediated regulation of ciliary beat frequency and mucociliary clearance in the airway. Might be involved in the regulation of intracellular calcium in tracheal epithelial cells.
PDB 3PH9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13899 Thioredoxin_7 43 → 124 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the lung, in the ciliated cells of the airway epithelium (PubMed:25751668). Expression increased with differentiation of airway epithelial cells (PubMed:25751668). Not detected in the mucous cells (PubMed:25751668). Expres
Sequence 
MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKK
PLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIM
FVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Sequence length 166
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CERVICAL CANCER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (18)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma Associate 35857928
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 25875093, 31291711, 32444848, 33176066, 34057117
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 35857928, 36593009
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Ductal Associate 31291711
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Ductal Breast Associate 31291711
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Intraductal Noninfiltrating Associate 28178722
★★★★★
★☆☆☆☆
Found in Text Mining only
Dermatitis Allergic Contact Associate 35028126
★★★★★
★☆☆☆☆
Found in Text Mining only
Hepatitis B Associate 31291711
★★★★★
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Stimulate 36593009
★★★★★
★☆☆☆☆
Found in Text Mining only
Melanoma Cutaneous Malignant Associate 29739929
★★★★★
★☆☆☆☆
Found in Text Mining only