Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1553
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome P450 family 2 subfamily A member 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYP2A13
Synonyms (NCBI Gene) Gene synonyms aliases	CPAD, CYP2A, CYPIIA13
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments
MIRT1972976	hsa-miR-1226	CLIP-seq
MIRT1972977	hsa-miR-3130-3p	CLIP-seq
MIRT1972978	hsa-miR-3173-5p	CLIP-seq
MIRT1972979	hsa-miR-634	CLIP-seq
MIRT1972980	hsa-miR-767-5p	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006082	Process	Organic acid metabolic process	IBA	21873635
GO:0006805	Process	Xenobiotic metabolic process	IBA	21873635
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008392	Function	Arachidonic acid epoxygenase activity	IBA	21873635
GO:0008395	Function	Steroid hydroxylase activity	IBA	21873635
GO:0009804	Process	Coumarin metabolic process	IBA	21873635
GO:0009804	Process	Coumarin metabolic process	TAS
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	21873635
GO:0019373	Process	Epoxygenase P450 pathway	IBA	21873635
GO:0020037	Function	Heme binding	IBA	21873635
GO:0020037	Function	Heme binding	IDA	17428784
GO:0042738	Process	Exogenous drug catabolic process	IBA	21873635
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA	21873635
GO:0070330	Function	Aromatase activity	IEA

MIM	HGNC	e!Ensembl
608055	2608	ENSG00000197838

Protein

UniProt ID

Q16696

Protein name

Cytochrome P450 2A13 (EC 1.14.14.1) (CYPIIA13)

Protein function

Exhibits a coumarin 7-hydroxylase activity. Active in the metabolic activation of hexamethylphosphoramide, N,N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco-specific carcinogen, 4-(methylnitrosamino)-1-(3-p

PDB

2P85 , 2PG5 , 2PG6 , 2PG7 , 3T3S , 4EJG , 4EJH , 4EJI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	34 → 491	Cytochrome P450	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver and a number of extrahepatic tissues, including nasal mucosa, lung, trachea, brain, mammary gland, prostate, testis, and uterus, but not in heart, kidney, bone marrow, colon, small intestine, spleen, stomach, thymus,

Sequence

MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR

Sequence length

494

Interactions

View interactions

	KEGG		Reactome
	Metabolism of xenobiotics by cytochrome P450 Chemical carcinogenesis - DNA adducts		Fatty acids Xenobiotics CYP2E1 reactions Aflatoxin activation and detoxification

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	18669584

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Adrenocortical Carcinoma	Associate	28073588
Breast Neoplasms	Stimulate	26311227
Carcinogenesis	Associate	30807688
Diarrhea	Associate	28811232
Drug Related Side Effects and Adverse Reactions	Associate	29027939
Esophageal Neoplasms	Associate	19339270
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34050721
Lung Neoplasms	Associate	27488534, 30807688, 32803792, 33327254, 38117513
Neoplasms	Associate	21791872
Ovarian Diseases	Associate	25298284
Pancreatic Neoplasms	Associate	24651674
Pulmonary Disease Chronic Obstructive	Associate	32803792
Smoke Inhalation Injury	Associate	32803792
Urinary Bladder Neoplasms	Associate	27725446

CYP2A13 (cytochrome P450 family 2 subfamily A member 13)