Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1549
Gene name	Cytochrome P450 family 2 subfamily A member 7
Gene symbol	CYP2A7
Synonyms (NCBI Gene)	CPA7CPADCYP2ACYPIIA7P450-IIA4
Chromosome	19
Chromosome location	19q13.2
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615874	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT615873	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT2447911	hsa-miR-4292	CLIP-seq
MIRT2447912	hsa-miR-4308	CLIP-seq
MIRT2447913	hsa-miR-4446-5p	CLIP-seq
MIRT2447914	hsa-miR-4755-5p	CLIP-seq
MIRT2447915	hsa-miR-670	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0008392	Function	Arachidonate epoxygenase activity	IBA
GO:0009804	Process	Coumarin metabolic process	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019373	Process	Epoxygenase P450 pathway	IBA
GO:0019825	Function	Oxygen binding	TAS	7864805
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
608054	2611	ENSG00000198077

P20853

Protein name

Cytochrome P450 2A7 (EC 1.14.14.1) (CYPIIA7) (Cytochrome P450 IIA4)

Protein function

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty aci

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00067	p450	34 → 491	Cytochrome P450	Domain

Sequence

MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMK
FSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSN
GERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKL
LQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQ
RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVF
ATIPRNYTMSFLPR

Sequence length

494

Interactions

View interactions

	KEGG		Reactome
	Caffeine metabolism Retinol metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Chemical carcinogenesis - DNA adducts Lipid and atherosclerosis		Fatty acids Xenobiotics CYP2E1 reactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenomatous Polyposis Coli	Associate	28306719	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	28073588	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30971588	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	28306719	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30948450	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	28145423, 38097766	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	29767774	★★★★★ ★☆☆☆☆ Found in Text Mining only

CYP2A7 (cytochrome P450 family 2 subfamily A member 7)