Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
154881
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium channel tetramerization domain containing 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCTD7
Synonyms (NCBI Gene) Gene synonyms aliases
CLN14, EPM3
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the potassium channel tetramerization domain-containing protein family. Family members are identified on a structural basis and contain an amino-terminal domain similar to the T1 domain present in the voltage-gated potassium
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs139585796 C>T Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs140932942 C>T Benign, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs199624315 G>A,T Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
rs200652879 C>G,T Likely-pathogenic Missense variant, coding sequence variant
rs201296399 A>G Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051052 hsa-miR-17-5p CLASH 23622248
MIRT048921 hsa-miR-92a-3p CLASH 23622248
MIRT044637 hsa-miR-320a CLASH 23622248
MIRT620881 hsa-miR-548c-3p HITS-CLIP 23824327
MIRT620880 hsa-miR-1295b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22748208, 32296183, 38225382
GO:0005737 Component Cytoplasm IDA 22748208
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611725 21957 ENSG00000243335
Protein
UniProt ID Q96MP8
Protein name BTB/POZ domain-containing protein KCTD7
Protein function May be involved in the control of excitability of cortical neurons.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02214 BTB_2 53 141 BTB/POZ domain Domain
Sequence
MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPEVVPLNIGGA
HFTTRLSTLRCYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPRE
RVRAVYKEAQYYAIGPLLEQL
ENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQ
RKARFAKLKVCVFKEEMPITPYECPLLNSLRFERSESDGQLFEHHCEVDVSFGPWEAVAD
VYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRPIYEFKITWW
Sequence length 289
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epileptic encephalopathy epileptic encephalopathy rs1584399108 N/A
Progressive Myoclonic Epilepsy progressive myoclonic epilepsy type 3 rs267607199, rs1554397834, rs387907246, rs747676224, rs727502785, rs1786631768, rs387907260, rs387907261, rs387907262, rs387907263, rs750811871, rs1554397774 N/A
progressive myoclonic epilepsy Progressive myoclonic epilepsy rs1554397774 N/A
neuronal ceroid lipofuscinosis Neuronal ceroid lipofuscinosis rs387907246 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Epilepsy progressive myoclonus epilepsy N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ataxia Associate 25060828
Epilepsies Myoclonic Associate 25060828
Epilepsy Associate 25060828
Epilepsy Rolandic Associate 29789371
Glioblastoma Associate 31674730
Immunologic Deficiency Syndromes Associate 30295347
Lysosomal Storage Diseases Associate 36368077
Movement Disorders Associate 30295347
Myoclonic Epilepsies Progressive Associate 30295347
Neurodegenerative Diseases Associate 30295347