Gene Gene information from NCBI Gene database.
Entrez ID 154881
Gene name Potassium channel tetramerization domain containing 7
Gene symbol KCTD7
Synonyms (NCBI Gene)
CLN14EPM3
Chromosome 7
Chromosome location 7q11.21
Summary This gene encodes a member of the potassium channel tetramerization domain-containing protein family. Family members are identified on a structural basis and contain an amino-terminal domain similar to the T1 domain present in the voltage-gated potassium
SNPs SNP information provided by dbSNP.
25
SNP ID Visualize variation Clinical significance Consequence
rs139585796 C>T Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs140932942 C>T Benign, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs199624315 G>A,T Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
rs200652879 C>G,T Likely-pathogenic Missense variant, coding sequence variant
rs201296399 A>G Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
211
miRTarBase ID miRNA Experiments Reference
MIRT051052 hsa-miR-17-5p CLASH 23622248
MIRT048921 hsa-miR-92a-3p CLASH 23622248
MIRT044637 hsa-miR-320a CLASH 23622248
MIRT620881 hsa-miR-548c-3p HITS-CLIP 23824327
MIRT620880 hsa-miR-1295b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22748208, 32296183, 38225382
GO:0005737 Component Cytoplasm IDA 22748208
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611725 21957 ENSG00000243335
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96MP8
Protein name BTB/POZ domain-containing protein KCTD7
Protein function May be involved in the control of excitability of cortical neurons.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02214 BTB_2 53 141 BTB/POZ domain Domain
Sequence
MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPEVVPLNIGGA
HFTTRLSTLRCYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPRE
RVRAVYKEAQYYAIGPLLEQL
ENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQ
RKARFAKLKVCVFKEEMPITPYECPLLNSLRFERSESDGQLFEHHCEVDVSFGPWEAVAD
VYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRPIYEFKITWW
Sequence length 289
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
413
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Epilepsy, progressive myoclonic, 3, with intracellular inclusions Likely pathogenic; Pathogenic rs387907246 RCV000030608
Epileptic encephalopathy Likely pathogenic rs1584399108 RCV001003965
Intellectual disability Likely pathogenic; Pathogenic rs750811871 RCV005625595
KCTD7-related disorder Likely pathogenic; Pathogenic rs141191660 RCV004754810
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neuronal ceroid lipofuscinosis 1 Uncertain significance rs766856368 RCV003483854
Nonpapillary renal cell carcinoma Uncertain significance rs184129807 RCV005899255
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Ataxia Associate 25060828
Epilepsies Myoclonic Associate 25060828
Epilepsy Associate 25060828
Epilepsy Rolandic Associate 29789371
Glioblastoma Associate 31674730
Immunologic Deficiency Syndromes Associate 30295347
Lysosomal Storage Diseases Associate 36368077
Movement Disorders Associate 30295347
Myoclonic Epilepsies Progressive Associate 30295347
Neurodegenerative Diseases Associate 30295347