CCDC167 (coiled-coil domain containing 167)

Gene

• Entrez ID: 154467
• Gene name: Coiled-coil domain containing 167
• Gene symbol: CCDC167
• Synonyms (NCBI Gene): C6orf129, HSPC265
• Chromosome: 6
• Chromosome location: 6p21.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT868637	hsa-miR-1273e	CLIP-seq
MIRT868638	hsa-miR-1304	CLIP-seq
MIRT868639	hsa-miR-2467-5p	CLIP-seq
MIRT868640	hsa-miR-3188	CLIP-seq
MIRT868641	hsa-miR-3616-5p	CLIP-seq
MIRT868642	hsa-miR-3647-5p	CLIP-seq
MIRT868643	hsa-miR-3975	CLIP-seq
MIRT868644	hsa-miR-4635	CLIP-seq
MIRT868645	hsa-miR-4763-5p	CLIP-seq
MIRT868646	hsa-miR-4795-5p	CLIP-seq
MIRT868647	hsa-miR-485-5p	CLIP-seq
MIRT868648	hsa-miR-515-3p	CLIP-seq
MIRT868649	hsa-miR-519e	CLIP-seq
MIRT868650	hsa-miR-550a	CLIP-seq
MIRT868651	hsa-miR-573	CLIP-seq
MIRT1957757	hsa-miR-3689a-3p	CLIP-seq
MIRT1957758	hsa-miR-3689c	CLIP-seq
MIRT1957759	hsa-miR-4425	CLIP-seq
MIRT1957760	hsa-miR-4704-5p	CLIP-seq
MIRT1957761	hsa-miR-4728-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9P0B6
• Protein name: Coiled-coil domain-containing protein 167
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15188	CCDC-167	10 → 93	Coiled-coil domain-containing protein 167	Coiled-coil

• Sequence:

  MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKA
  SNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM

• Sequence length: 97

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	33461170	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	39245738	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	33461170	★☆☆☆☆ Found in Text Mining only