Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
153572
Gene name Gene Name - the full gene name approved by the HGNC.
Iroquois homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IRX2
Synonyms (NCBI Gene) Gene synonyms aliases
IRXA2
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p15.33
Summary Summary of gene provided in NCBI Entrez Gene.
IRX2 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM, Apr 2004]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017070 hsa-miR-335-5p Microarray 18185580
MIRT635297 hsa-miR-330-3p HITS-CLIP 23824327
MIRT635296 hsa-miR-4504 HITS-CLIP 23824327
MIRT635295 hsa-miR-542-3p HITS-CLIP 23824327
MIRT635294 hsa-miR-6808-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 26560478
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606198 14359 ENSG00000170561
Protein
UniProt ID Q9BZI1
Protein name Iroquois-class homeodomain protein IRX-2 (Homeodomain protein IRXA2) (Iroquois homeobox protein 2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05920 Homeobox_KN 132 171 Homeobox KN domain Family
Sequence
MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAAT
GFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKN
ATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTW
APRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEK
LPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPP
EAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAP
ASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEA
LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL
Sequence length 471
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 24921089
Adenocarcinoma of Lung Stimulate 35102706
Astrocytoma Associate 26497896
Breast Neoplasms Associate 19706770, 26560478
Carcinoma in Situ Associate 30108103
Carcinoma Squamous Cell Associate 22143938
Leukemia Associate 31599112
Leukemia Myeloid Acute Associate 31599112
Mouth Neoplasms Inhibit 34717154
Neoplasm Metastasis Associate 26560478