Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	153328
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 25 member 48
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC25A48
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q31.1

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments
MIRT1357359	hsa-miR-128	CLIP-seq
MIRT1357360	hsa-miR-1827	CLIP-seq
MIRT1357361	hsa-miR-1915	CLIP-seq
MIRT1357362	hsa-miR-302a	CLIP-seq
MIRT1357363	hsa-miR-302b	CLIP-seq
MIRT1357364	hsa-miR-302c	CLIP-seq
MIRT1357365	hsa-miR-302d	CLIP-seq
MIRT1357366	hsa-miR-302e	CLIP-seq
MIRT1357367	hsa-miR-3117-5p	CLIP-seq
MIRT1357368	hsa-miR-3150b-3p	CLIP-seq
MIRT1357369	hsa-miR-324-5p	CLIP-seq
MIRT1357370	hsa-miR-372	CLIP-seq
MIRT1357371	hsa-miR-373	CLIP-seq
MIRT1357372	hsa-miR-4645-5p	CLIP-seq
MIRT1357373	hsa-miR-4673	CLIP-seq
MIRT1357374	hsa-miR-4689	CLIP-seq
MIRT1357375	hsa-miR-4711-5p	CLIP-seq
MIRT1357376	hsa-miR-4726-3p	CLIP-seq
MIRT1357377	hsa-miR-4784	CLIP-seq
MIRT1357378	hsa-miR-519a	CLIP-seq
MIRT1357379	hsa-miR-519b-3p	CLIP-seq
MIRT1357380	hsa-miR-519c-3p	CLIP-seq
MIRT1357381	hsa-miR-520a-3p	CLIP-seq
MIRT1357382	hsa-miR-520b	CLIP-seq
MIRT1357383	hsa-miR-520c-3p	CLIP-seq
MIRT1357384	hsa-miR-520d-3p	CLIP-seq
MIRT1357385	hsa-miR-520e	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006844	Process	Acyl carnitine transport	IBA	21873635
GO:0006865	Process	Amino acid transport	IBA	21873635
GO:0015227	Function	Acyl carnitine transmembrane transporter activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:1902616	Process	Acyl carnitine transmembrane transport	IEA

MIM	HGNC	e!Ensembl
616150	30451	ENSG00000145832

Protein

UniProt ID

Q6ZT89

Protein name

Solute carrier family 25 member 48

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	3 → 91	Mitochondrial carrier protein	Family
PF00153	Mito_carr	100 → 209	Mitochondrial carrier protein	Family
PF00153	Mito_carr	214 → 306	Mitochondrial carrier protein	Family

Sequence

MGSFQLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFK
GMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGL
GGPVDLIKIRLQMQTQPFRDANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRG
ASAMLLRDVPGYCLYFIPYVFLSEWITPEACTGPSPCAVWLAGGMAGAISWGTATPMDVV
KSRLQADGVYLNKYKGVLDCISQSYQKEGLKVFFRGITVNAVRGFPMSAAMFLGYELSLQ
AIRGDHAVTSP

Sequence length

311

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	29274321

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.	GWAS, CBGDA
Schizophrenia	Schizophrenia		GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining
Parkinson Disease	Associate	21812969

SLC25A48 (solute carrier family 25 member 48)