Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
153222
Gene name Gene Name - the full gene name approved by the HGNC.
CREB3 regulatory factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREBRF
Synonyms (NCBI Gene) Gene synonyms aliases
C5orf41, LRF
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005103 hsa-miR-155-5p Microarray 19193853
MIRT016126 hsa-miR-421 Sequencing 20371350
MIRT017940 hsa-miR-335-5p Microarray 18185580
MIRT028082 hsa-miR-93-5p Sequencing 20371350
MIRT045087 hsa-miR-186-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18391022
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 16940180
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 16940180
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617109 24050 ENSG00000164463
Protein
UniProt ID Q8IUR6
Protein name CREB3 regulatory factor (Luman recruitment factor) (LRF)
Protein function Acts as a negative regulator of the endoplasmic reticulum stress response or unfolded protein response (UPR). Represses the transcriptional activity of CREB3 during the UPR. Recruits CREB3 into nuclear foci.
Family and domains
Sequence
MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFL
SLEDCKDIENLESFTDVLDNEGALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGL
DDFSSPYQDEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSVKQNPLPSSFPGKKITSR
AAAPVCSSKTLQAEVPLSDCVQKASKPTSSTQIMVKTNMYHNEKVNFHVECKDYVKKAKV
KINPVQQSRPLLSQIHTDAAKENTCYCGAVAKRQEKKGMEPLQGHATPALPFKETQELLL
SPLPQEGPGSLAAGESSSLSASTSVSDSSQKKEEHNYSLFVSDNLGEQPTKCSPEEDEED
EEDVDDEDHDEGFGSEHELSENEEEEEEEEDYEDDKDDDISDTFSEPGYENDSVEDLKEV
TSISSRKRGKRRYFWEYSEQLTPSQQERMLRPSEWNRDTLPSNMYQKNGLHHGKYAVKKS
RRTDVEDLTPNPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACRL
KKKAQYEANKVKLWGLNTEYDNLLFVINSIKQEIVNRVQNPRDERGPNMGQKLEILIKDT
LGLPVAGQTSEFVNQVLEKTAEGNPTGGLVGLRIPTSKV
Sequence length 639
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    CREB3 factors activate genes
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dyslexia Dyslexia N/A N/A GWAS
Obesity inherited obesity N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32699331
Anemia Sickle Cell Associate 32917636
Breast Neoplasms Associate 34990474
Diabetes Mellitus Associate 31280340, 32884101, 34340601
Diabetes Mellitus Type 2 Associate 31280340, 35144939, 36284436
Glioma Associate 27163161
Hypoxia Associate 27163161
Kidney Failure Chronic Associate 31280340
Neoplasms Adipose Tissue Associate 32491157
Obesity Associate 27455349, 31280340, 32190945, 32884101, 35606300