Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1528
Gene name Gene Name - the full gene name approved by the HGNC.
Cytochrome b5 type A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CYB5A
Synonyms (NCBI Gene) Gene synonyms aliases
CYB5, MCB5, METAG
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglob
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs794728010 T>C Pathogenic Splice acceptor variant
rs1555688659 T>A Likely-pathogenic Missense variant, coding sequence variant
rs1555691399 C>T Likely-pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023043 hsa-miR-124-3p Microarray 18668037
MIRT054659 hsa-miR-223-3p Luciferase reporter assay, qRT-PCR, Western blot 24078287
MIRT664401 hsa-miR-106a-5p HITS-CLIP 23824327
MIRT664400 hsa-miR-106b-5p HITS-CLIP 23824327
MIRT664399 hsa-miR-17-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005741 Component Mitochondrial outer membrane TAS
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613218 2570 ENSG00000166347
Protein
UniProt ID P00167
Protein name Cytochrome b5 (Microsomal cytochrome b5 type A) (MCB5)
Protein function Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.
PDB 2I96
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00173 Cyt-b5 13 85 Cytochrome b5-like Heme/Steroid binding domain Domain
Sequence
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELH
PDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
Sequence length 134
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Vitamin C (ascorbate) metabolism
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Methemoglobinemia Methemoglobinemia type 4 rs794728010, rs1555691399, rs1555688659 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
17 20 Lyase Deficiency Isolated Associate 22170710
Adrenal Gland Neoplasms Associate 37543511
Adrenal Hyperplasia Congenital Associate 28609197, 34616364
Adrenal Rest Tumor Associate 34616364
Arthritis Rheumatoid Associate 25890314
Breast Neoplasms Associate 25225034
Carcinoma Hepatocellular Associate 19161326, 39251909
Carcinoma Pancreatic Ductal Inhibit 24301457
Carcinoma Renal Cell Associate 35140327
Congenital adrenal hyperplasia due to 11 Beta hydroxylase deficiency Associate 28609197