Gene Gene information from NCBI Gene database.
Entrez ID 1528
Gene name Cytochrome b5 type A
Gene symbol CYB5A
Synonyms (NCBI Gene)
CYB5MCB5METAG
Chromosome 18
Chromosome location 18q22.3
Summary The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglob
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs794728010 T>C Pathogenic Splice acceptor variant
rs1555688659 T>A Likely-pathogenic Missense variant, coding sequence variant
rs1555691399 C>T Likely-pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
192
miRTarBase ID miRNA Experiments Reference
MIRT023043 hsa-miR-124-3p Microarray 18668037
MIRT054659 hsa-miR-223-3p Luciferase reporter assayqRT-PCRWestern blot 24078287
MIRT664401 hsa-miR-106a-5p HITS-CLIP 23824327
MIRT664400 hsa-miR-106b-5p HITS-CLIP 23824327
MIRT664399 hsa-miR-17-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005741 Component Mitochondrial outer membrane TAS
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613218 2570 ENSG00000166347
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P00167
Protein name Cytochrome b5 (Microsomal cytochrome b5 type A) (MCB5)
Protein function Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.
PDB 2I96
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00173 Cyt-b5 13 85 Cytochrome b5-like Heme/Steroid binding domain Domain
Sequence
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELH
PDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
Sequence length 134
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Vitamin C (ascorbate) metabolism
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
21
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Methemoglobinemia type 4 Pathogenic; Likely pathogenic rs794728010, rs1555691399, rs1555688659 RCV000000254
RCV000627675
RCV000627676
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs146344037 RCV005927996
Adrenocortical carcinoma, hereditary Benign rs7238987 RCV005928002
Cervical cancer Benign rs150530087 RCV005928110
Cholangiocarcinoma Benign rs7238987 RCV005928005
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
17 20 Lyase Deficiency Isolated Associate 22170710
Adrenal Gland Neoplasms Associate 37543511
Adrenal Hyperplasia Congenital Associate 28609197, 34616364
Adrenal Rest Tumor Associate 34616364
Arthritis Rheumatoid Associate 25890314
Breast Neoplasms Associate 25225034
Carcinoma Hepatocellular Associate 19161326, 39251909
Carcinoma Pancreatic Ductal Inhibit 24301457
Carcinoma Renal Cell Associate 35140327
Congenital adrenal hyperplasia due to 11 Beta hydroxylase deficiency Associate 28609197