RDUR (RIG-I dependent antiviral response regulator RNA)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
152225
Gene name Gene Name - the full gene name approved by the HGNC.
RIG-I dependent antiviral response regulator RNA
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RDUR
Synonyms (NCBI Gene) Gene synonyms aliases
LINC02085
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q12.3
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0045087 Process Innate immune response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q0VG73
Protein name Putative protein RDUR (RIG-I dependent antiviral response regulator RNA)
Protein function Could play a role in innate immunity against viruses.
Family and domains
Sequence 
MNNSFNKEDRMSSDTMVGSCDRQTKNGAKWHGGVSSLLDFTLIYIQLSTSFQNAGHSFKK
QHICSDFEVMDELSCAVYGNKFYYLLPTLTHPSIQ
Sequence length 95
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS