RDUR (RIG-I dependent antiviral response regulator RNA)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 152225
Gene name RIG-I dependent antiviral response regulator RNA
Gene symbol RDUR
Synonyms (NCBI Gene)
LINC02085
Chromosome 3
Chromosome location 3q12.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Gene Gene ontology Other IDs Protein
Show/Hide all (3)
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0045087 Process Innate immune response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q0VG73
Protein name Putative protein RDUR (RIG-I dependent antiviral response regulator RNA)
Protein function Could play a role in innate immunity against viruses.
Family and domains
Sequence 
MNNSFNKEDRMSSDTMVGSCDRQTKNGAKWHGGVSSLLDFTLIYIQLSTSFQNAGHSFKK
QHICSDFEVMDELSCAVYGNKFYYLLPTLTHPSIQ
Sequence length 95
Interactions View interactions