Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	152110
Gene name Gene Name - the full gene name approved by the HGNC.	NIMA related kinase 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NEK10
Synonyms (NCBI Gene) Gene synonyms aliases	CILD44
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CILD44
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p24.1

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs766982731	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, genic downstream transcript variant, missense variant
rs1253689023	C>G	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, intron variant
rs1575215909	G>A	Pathogenic	Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs1575588483	->A	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant, genic upstream transcript variant

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments
MIRT1180071	hsa-miR-1184	CLIP-seq
MIRT1180072	hsa-miR-1205	CLIP-seq
MIRT1180073	hsa-miR-24	CLIP-seq
MIRT1180074	hsa-miR-3158-5p	CLIP-seq
MIRT1180075	hsa-miR-3914	CLIP-seq
MIRT1180076	hsa-miR-4284	CLIP-seq
MIRT1180077	hsa-miR-4700-3p	CLIP-seq
MIRT1180078	hsa-miR-4718	CLIP-seq
MIRT1180079	hsa-miR-544	CLIP-seq
MIRT1180080	hsa-miR-873	CLIP-seq
MIRT1180071	hsa-miR-1184	CLIP-seq
MIRT1180072	hsa-miR-1205	CLIP-seq
MIRT1180074	hsa-miR-3158-5p	CLIP-seq
MIRT1180075	hsa-miR-3914	CLIP-seq
MIRT1180077	hsa-miR-4700-3p	CLIP-seq
MIRT1180078	hsa-miR-4718	CLIP-seq
MIRT1180079	hsa-miR-544	CLIP-seq
MIRT1180080	hsa-miR-873	CLIP-seq
MIRT1180071	hsa-miR-1184	CLIP-seq
MIRT1180072	hsa-miR-1205	CLIP-seq
MIRT2281433	hsa-miR-23a	CLIP-seq
MIRT2281434	hsa-miR-23b	CLIP-seq
MIRT2281435	hsa-miR-23c	CLIP-seq
MIRT1180074	hsa-miR-3158-5p	CLIP-seq
MIRT1180077	hsa-miR-4700-3p	CLIP-seq
MIRT1180078	hsa-miR-4718	CLIP-seq
MIRT1180079	hsa-miR-544	CLIP-seq
MIRT1180071	hsa-miR-1184	CLIP-seq
MIRT1180072	hsa-miR-1205	CLIP-seq
MIRT1180074	hsa-miR-3158-5p	CLIP-seq
MIRT1180077	hsa-miR-4700-3p	CLIP-seq
MIRT1180078	hsa-miR-4718	CLIP-seq
MIRT1180079	hsa-miR-544	CLIP-seq
MIRT1180080	hsa-miR-873	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	IDA	20956560
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0006468	Process	Protein phosphorylation	IDA	20956560
GO:0031954	Process	Positive regulation of protein autophosphorylation	IDA	20956560
GO:0043406	Process	Positive regulation of MAP kinase activity	IBA	21873635
GO:0043406	Process	Positive regulation of MAP kinase activity	IMP	20956560
GO:0046872	Function	Metal ion binding	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IMP	20956560
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:0120197	Process	Mucociliary clearance	IMP	31959991
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	IBA	21873635
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	IMP	20956560
GO:1902911	Component	Protein kinase complex	IDA	20956560

MIM	HGNC	e!Ensembl
618726	18592	ENSG00000163491

Protein

UniProt ID

Q6ZWH5

Protein name

Serine/threonine-protein kinase Nek10 (EC 2.7.11.1) (Never in mitosis A-related kinase 10) (NimA-related protein kinase 10)

Protein function

Plays a role in the cellular response to UV irradiation. Mediates G2/M cell cycle arrest, MEK autoactivation and ERK1/2-signaling pathway activation in response to UV irradiation. In ciliated cells of airways, it is involved in the regulation of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	519 → 783	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the lung. {ECO:0000269|PubMed:31959991}.

Sequence

MPDQDKKVKTTEKSTDKQQEITIRDYSDLKRLRCLLNVQSSKQQLPAINFDSAQNSMTKS
EPAIRAGGHRARGQWHESTEAVELENFSINYKNERNFSKHPQRKLFQEIFTALVKNRLIS
REWVNRAPSIHFLRVLICLRLLMRDPCYQEILHSLGGIENLAQYMEIVANEYLGYGEEQH
TVDKLVNMTYIFQKLAAVKDQREWVTTSGAHKTLVNLLGARDTNVLLGSLLALASLAESQ
ECREKISELNIVENLLMILHEYDLLSKRLTAELLRLLCAEPQVKEQVKLYEGIPVLLSLL
HSDHLKLLWSIVWILVQVCEDPETSVEIRIWGGIKQLLHILQGDRNFVSDHSSIGSLSSA
NAAGRIQQLHLSEDLSPREIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAKL
ILPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLFEIFIDIGHYVRDISA
YEELVSKLNLLVEDELKQIAENIESINQNKAPLKYIGNYAILDHLGSGAFGCVYKVRKHS
GQNLLAMKEVNLHNPAFGKDKKDRDSSVRNIVSELTIIKEQLYHPNIVRYYKTFLENDRL
YIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNN
IMLGDKDKVTVTDFGLAKQKQENSKLTSVVGTILYSCPEVLKSEPYGEKADVWAVGCILY
QMATLSPPFYSTNMLSLATKIVEAVYEPVPEGIYSEKVTDTISRCLTPDAEARPDIVEVS
SMISDVMMKYLDNLSTSQLSLEKKLERERRRTQRYFMEANRNTVTCHHELAVLSHETFEK
ASLSSSSSGAASLKSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYS
EVDDELDISDNSSSSSSSPLKESTFNILKRSFSASGGERQSQTRDFTGGTGSRPRPALLP
LDLLLKVPPHMLRAHIKEIEAELVTGWQSHSLPAVILRNLKDHGPQMGTFLWQASAGIAV
SQRKVRQISDPIQQILIQLHKIIYITQLPPALHHNLKRRVIERFKKSLFSQQSNPCNLKS
EIKKLSQGSPEPIEPNFFTADYHLLHRSSGGNSLSPNDPTGLPTSIELEEGITYEQMQTV
IEEVLEESGYYNFTSNRYHSYPWGTKNHPTKR

Sequence length

1172

Interactions

View interactions

Show/Hide Causal Diseases (9)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	19330027
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	24493630, 27197191, 29059683, 19330027
Ciliary dyskinesia	Primary ciliary dyskinesia	rs397515339, rs267607225, rs267607226, rs786205052, rs267607227, rs118204041, rs118204042, rs118204043, rs137853191, rs121434369, rs397515565, rs397515358, rs137852998, rs397515363, rs79833450 View all (813 more)
Colonic neoplasms	Malignant tumor of colon	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	27197191
Colorectal cancer	Colorectal Carcinoma, Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	27197191
Colorectal neoplasms	Colorectal Neoplasms, Malignant neoplasm of large intestine	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	27197191
Lung carcinoma	Squamous cell carcinoma of lung, Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	27197191
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	27197191
Prostate cancer	Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	27197191

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Evidence	Source
Unknown
Asthma	Asthma		GWAS
Uterine Fibroids	Uterine Fibroids		GWAS
Ovarian cancer	Ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth	GWAS, CBGDA
Dementia	Dementia		GWAS
Oligodendroglioma	Oligodendroglioma		GWAS
Cataract	Cataract		GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Stimulate	35260162
Breast Neoplasms	Associate	19330027, 24943594, 25881232, 29898891
Bronchiectasis	Associate	31959991
Ciliary Motility Disorders	Associate	32414360, 37998386
Ciliopathies	Associate	31959991
Respiratory Insufficiency	Associate	31959991

NEK10 (NIMA related kinase 10)