Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	152
Gene name Gene Name - the full gene name approved by the HGNC.	Adrenoceptor alpha 2C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADRA2C
Synonyms (NCBI Gene) Gene synonyms aliases	ADRA2L2, ADRA2RL2, ADRARL2, ALPHA2CAR
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.	Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments
MIRT769949	hsa-miR-1271	CLIP-seq
MIRT769950	hsa-miR-182	CLIP-seq
MIRT769951	hsa-miR-3150a-3p	CLIP-seq
MIRT769952	hsa-miR-3175	CLIP-seq
MIRT769953	hsa-miR-3936	CLIP-seq
MIRT769954	hsa-miR-4252	CLIP-seq
MIRT769955	hsa-miR-4271	CLIP-seq
MIRT769956	hsa-miR-4470	CLIP-seq
MIRT769957	hsa-miR-4489	CLIP-seq
MIRT769958	hsa-miR-4687-3p	CLIP-seq
MIRT769959	hsa-miR-4725-3p	CLIP-seq
MIRT769960	hsa-miR-4727-5p	CLIP-seq
MIRT769961	hsa-miR-4747-5p	CLIP-seq
MIRT769962	hsa-miR-4769-3p	CLIP-seq
MIRT769963	hsa-miR-483-5p	CLIP-seq
MIRT769964	hsa-miR-542-5p	CLIP-seq
MIRT769965	hsa-miR-625	CLIP-seq
MIRT769966	hsa-miR-647	CLIP-seq
MIRT769967	hsa-miR-939	CLIP-seq
MIRT769968	hsa-miR-96	CLIP-seq
MIRT1927080	hsa-miR-146b-3p	CLIP-seq
MIRT1927081	hsa-miR-1539	CLIP-seq
MIRT1927082	hsa-miR-1976	CLIP-seq
MIRT769951	hsa-miR-3150a-3p	CLIP-seq
MIRT1927083	hsa-miR-3173-5p	CLIP-seq
MIRT769952	hsa-miR-3175	CLIP-seq
MIRT1927084	hsa-miR-331-3p	CLIP-seq
MIRT1927085	hsa-miR-4536	CLIP-seq
MIRT1927086	hsa-miR-4722-3p	CLIP-seq
MIRT769963	hsa-miR-483-5p	CLIP-seq
MIRT1927087	hsa-miR-502-5p	CLIP-seq
MIRT769964	hsa-miR-542-5p	CLIP-seq
MIRT1927088	hsa-miR-874	CLIP-seq
MIRT769967	hsa-miR-939	CLIP-seq
MIRT2470524	hsa-miR-129-3p	CLIP-seq
MIRT2470525	hsa-miR-3690	CLIP-seq
MIRT2470526	hsa-miR-4254	CLIP-seq
MIRT2470527	hsa-miR-4434	CLIP-seq
MIRT2470528	hsa-miR-4516	CLIP-seq
MIRT2470529	hsa-miR-4531	CLIP-seq
MIRT2470530	hsa-miR-4690-3p	CLIP-seq

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004938	Function	Alpha2-adrenergic receptor activity	EXP	10948191
GO:0004938	Function	Alpha2-adrenergic receptor activity	IBA
GO:0004938	Function	Alpha2-adrenergic receptor activity	IDA	17215105
GO:0004938	Function	Alpha2-adrenergic receptor activity	IEA
GO:0004938	Function	Alpha2-adrenergic receptor activity	IMP	10647009
GO:0004938	Function	Alpha2-adrenergic receptor activity	TAS	9371698
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	16531006, 32296183
GO:0005737	Component	Cytoplasm	IDA	16605244
GO:0005768	Component	Endosome	TAS	10196213
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16605244
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9371698
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	17215105
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17215105
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9371698
GO:0010700	Process	Negative regulation of norepinephrine secretion	IEA
GO:0010700	Process	Negative regulation of norepinephrine secretion	IMP	10647009
GO:0010700	Process	Negative regulation of norepinephrine secretion	NAS	16531006
GO:0010700	Process	Negative regulation of norepinephrine secretion	TAS	19477270
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0031694	Function	Alpha-2A adrenergic receptor binding	IPI	16605244
GO:0032811	Process	Negative regulation of epinephrine secretion	NAS	16531006
GO:0042803	Function	Protein homodimerization activity	IDA	16605244
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	17215105
GO:0045666	Process	Positive regulation of neuron differentiation	IDA	17215105
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0046676	Process	Negative regulation of insulin secretion	TAS
GO:0046982	Function	Protein heterodimerization activity	IPI	16605244
GO:0051379	Function	Epinephrine binding	IBA
GO:0051379	Function	Epinephrine binding	IDA	17215105
GO:0051379	Function	Epinephrine binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17215105
GO:0071875	Process	Adrenergic receptor signaling pathway	IDA	17215105

MIM	HGNC	e!Ensembl
104250	283	ENSG00000184160

Protein

UniProt ID

P18825

Protein name

Alpha-2C adrenergic receptor (Alpha-2 adrenergic receptor subtype C4) (Alpha-2C adrenoreceptor) (Alpha-2C adrenoceptor) (Alpha-2CAR)

Protein function

Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.

PDB

6KUW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	68 → 437	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ

Sequence length

462

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Neuroactive ligand-receptor interaction Hormone signaling		Adrenoceptors Adrenaline signalling through Alpha-2 adrenergic receptor Adrenaline,noradrenaline inhibits insulin secretion G alpha (i) signalling events G alpha (z) signalling events Surfactant metabolism

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Ovarian cancer	Epithelial ovarian cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Inhibit	16407544
Attention Deficit Disorder with Hyperactivity	Associate	11326305
Breast Neoplasms	Associate	31218733
Calcinosis Cutis	Stimulate	31218733
Cardiomyopathy Dilated	Associate	18776959
Colorectal Neoplasms	Associate	24308539
Constipation	Associate	15138209
Death	Associate	18947427
Dementia	Associate	17324522
Fetal Growth Retardation	Stimulate	30273604
Gastrointestinal Diseases	Associate	15138209
Heart Failure	Associate	12374873, 15319474, 16188498, 18320080, 18776959, 18947427, 20128806
Hypertension	Associate	19742303
LEOPARD Syndrome	Associate	15319474
Lewy Body Disease	Inhibit	16407544
Medically Unexplained Symptoms	Associate	15138209
Neoplasms	Stimulate	31218733
Nerve Degeneration	Associate	17324522
Raynaud Disease	Associate	39793863
Severe Acute Respiratory Syndrome	Associate	30273604
Ventricular Fibrillation	Associate	36926933

ADRA2C (adrenoceptor alpha 2C)