Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
151827
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat containing 34
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRRC34
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q26.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT038798 hsa-miR-93-3p CLASH 23622248
MIRT1119562 hsa-miR-374c CLIP-seq
MIRT1119563 hsa-miR-3941 CLIP-seq
MIRT1119564 hsa-miR-4528 CLIP-seq
MIRT1119565 hsa-miR-4643 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000723 Process Telomere maintenance IEA
GO:0003674 Function Molecular_function ND
GO:0005575 Component Cellular_component ND
GO:0005634 Component Nucleus IEA
GO:0005730 Component Nucleolus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619037 28408 ENSG00000171757
Protein
UniProt ID Q8IZ02
Protein name Leucine-rich repeat-containing protein 34
Protein function Highly expressed in stem cells where it may be involved in regulation of pluripotency. In embryonic stem cells (ESCs), important for normal expression of the pluripotency regulators POU5F1/OCT4 and KLF4. Also important for expression of the ecto
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13516 LRR_6 149 172 Leucine Rich repeat Repeat
PF13516 LRR_6 177 200 Leucine Rich repeat Repeat
PF13516 LRR_6 206 228 Leucine Rich repeat Repeat
PF13516 LRR_6 292 315 Leucine Rich repeat Repeat
PF13516 LRR_6 320 343 Leucine Rich repeat Repeat
PF13516 LRR_6 349 372 Leucine Rich repeat Repeat
Sequence
MAAQPPRPVGERSMGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNL
CMEKSQKINPFILHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILK
NCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRT
LKYLRMTGNKIENKGGMFFA
AMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQNQAIKAI
NLNRPILYSEQEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLD
VSCNKITHDGMVYLA
DVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVS
NNIEGEGLVALS
QSMKTNLTFSHIYIWGNKFDEATCIAYSDLIQMGCLKPDNTDVEPFVV
DGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP
Sequence length 464
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carcinoma Basal cell carcinoma N/A N/A GWAS
Multiple myeloma Multiple myeloma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ciliopathies Associate 32055034
Coronary Disease Associate 24349443
Death Associate 33763035
Diabetes Mellitus Type 2 Associate 24349443
Heart Failure Associate 33763035
Lung Diseases Interstitial Associate 26792595
Neoplasms Associate 34373545
Scleroderma Systemic Associate 26792595
Thyroid Neoplasms Associate 28195142