Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	151827
Gene name Gene Name - the full gene name approved by the HGNC.	Leucine rich repeat containing 34
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LRRC34
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q26.2

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038798	hsa-miR-93-3p	CLASH	23622248
MIRT1119562	hsa-miR-374c	CLIP-seq
MIRT1119563	hsa-miR-3941	CLIP-seq
MIRT1119564	hsa-miR-4528	CLIP-seq
MIRT1119565	hsa-miR-4643	CLIP-seq
MIRT1119566	hsa-miR-466	CLIP-seq
MIRT1119567	hsa-miR-4672	CLIP-seq
MIRT1119568	hsa-miR-4789-3p	CLIP-seq
MIRT1119569	hsa-miR-655	CLIP-seq
MIRT1119570	hsa-miR-4735-5p	CLIP-seq
MIRT1119571	hsa-miR-622	CLIP-seq
MIRT1119572	hsa-miR-633	CLIP-seq
MIRT1550934	hsa-miR-1264	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence
GO:0003674	Function	Molecular_function	ND
GO:0005575	Component	Cellular_component	ND
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0008150	Process	Biological_process	ND
GO:0030154	Process	Cell differentiation	IEA

MIM	HGNC	e!Ensembl
619037	28408	ENSG00000171757

Protein

UniProt ID

Q8IZ02

Protein name

Leucine-rich repeat-containing protein 34

Protein function

Highly expressed in stem cells where it may be involved in regulation of pluripotency. In embryonic stem cells (ESCs), important for normal expression of the pluripotency regulators POU5F1/OCT4 and KLF4. Also important for expression of the ecto

PDB

8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13516	LRR_6	149 → 172	Leucine Rich repeat	Repeat
PF13516	LRR_6	177 → 200	Leucine Rich repeat	Repeat
PF13516	LRR_6	206 → 228	Leucine Rich repeat	Repeat
PF13516	LRR_6	292 → 315	Leucine Rich repeat	Repeat
PF13516	LRR_6	320 → 343	Leucine Rich repeat	Repeat
PF13516	LRR_6	349 → 372	Leucine Rich repeat	Repeat

Sequence

MAAQPPRPVGERSMGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNL
CMEKSQKINPFILHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILK
NCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRT
LKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQNQAIKAI
NLNRPILYSEQEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLD
VSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVS
NNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEATCIAYSDLIQMGCLKPDNTDVEPFVV
DGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP

Sequence length

464

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962 View all (38 more)	23955597, 27363682
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	31407831

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Carcinoma	Carcinoma			GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Ciliopathies	Associate	32055034
Coronary Disease	Associate	24349443
Death	Associate	33763035
Diabetes Mellitus Type 2	Associate	24349443
Heart Failure	Associate	33763035
Lung Diseases Interstitial	Associate	26792595
Neoplasms	Associate	34373545
Scleroderma Systemic	Associate	26792595
Thyroid Neoplasms	Associate	28195142

LRRC34 (leucine rich repeat containing 34)