SGO1 (shugoshin 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 151648
Gene name Shugoshin 1
Gene symbol SGO1
Synonyms (NCBI Gene)
CAIDNY-BR-85SGOSGOL1
Chromosome 3
Chromosome location 3p24.3
Summary The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this g
miRNA miRNA information provided by mirtarbase database.
60
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (60)
miRTarBase ID miRNA Experiments Reference
MIRT634348 hsa-miR-500b-3p HITS-CLIP 23824327
MIRT634347 hsa-miR-6741-3p HITS-CLIP 23824327
MIRT634346 hsa-miR-1307-3p HITS-CLIP 23824327
MIRT634345 hsa-miR-4638-5p HITS-CLIP 23824327
MIRT634344 hsa-miR-6773-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (33)
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IDA 16682347, 24055156
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 16582621, 17621308
GO:0000776 Component Kinetochore IDA 17617734, 18331714, 24157919
GO:0000776 Component Kinetochore IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609168 25088 ENSG00000129810
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5FBB7
Protein name Shugoshin 1 (Serologically defined breast cancer antigen NY-BR-85) (Shugoshin-like 1)
Protein function Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphoryla
PDB 3FGA , 3Q6S , 4A0I , 7ZJS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07558 Shugoshin_N 22 → 66 Shugoshin N-terminal coiled-coil region Coiled-coil
PF07557 Shugoshin_C 474 → 496 Shugoshin C terminus Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested. {ECO:0000269|PubMed:12747765}.
Sequence 
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDN
NKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSS
GMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKS
TDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPEN
VQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREE
NNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTA
SVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVR
EFVSRFPDCRKCKLETHICLR
Sequence length 561
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cell cycle
Oocyte meiosis 		  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
15
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cardiovascular phenotype Pathogenic rs199815268 RCV005404271
Chronic atrial and intestinal dysrhythmia Pathogenic rs199815268 RCV000150047
SGO1-related disorder Pathogenic rs199815268 RCV004758652
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Conflicting classifications of pathogenicity rs142110258 RCV005908534
Familial cancer of breast Conflicting classifications of pathogenicity rs142110258 RCV005908533
Lung cancer Conflicting classifications of pathogenicity rs142110258 RCV005908535
Show/Hide Text Mining Associations (11)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 32923148
Aneuploidy Associate 25736928, 35044816
Arrhythmias Cardiac Associate 30739867
Carcinogenesis Associate 22161216, 23564482, 38077434
Carcinoma Hepatocellular Associate 25638162
Carcinoma Non Small Cell Lung Associate 22161216, 24146025
Intestinal Pseudo Obstruction Associate 30739867
Leukemia Lymphocytic Chronic B Cell Associate 31278357
Lung Neoplasms Associate 22161216
Neoplasms Associate 24074379