Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
151648
Gene name Gene Name - the full gene name approved by the HGNC.
Shugoshin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SGO1
Synonyms (NCBI Gene) Gene synonyms aliases
CAID, NY-BR-85, SGO, SGOL1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p24.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this g
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT634348 hsa-miR-500b-3p HITS-CLIP 23824327
MIRT634347 hsa-miR-6741-3p HITS-CLIP 23824327
MIRT634346 hsa-miR-1307-3p HITS-CLIP 23824327
MIRT634345 hsa-miR-4638-5p HITS-CLIP 23824327
MIRT634344 hsa-miR-6773-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IDA 16682347, 24055156
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 16582621, 17621308
GO:0000776 Component Kinetochore IDA 17617734, 18331714, 24157919
GO:0000776 Component Kinetochore IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609168 25088 ENSG00000129810
Protein
UniProt ID Q5FBB7
Protein name Shugoshin 1 (Serologically defined breast cancer antigen NY-BR-85) (Shugoshin-like 1)
Protein function Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphoryla
PDB 3FGA , 3Q6S , 4A0I , 7ZJS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07558 Shugoshin_N 22 66 Shugoshin N-terminal coiled-coil region Coiled-coil
PF07557 Shugoshin_C 474 496 Shugoshin C terminus Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested. {ECO:0000269|PubMed:12747765}.
Sequence
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDN
NKMLVL
ALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSS
GMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKS
TDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPEN
VQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREE
NNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTA
SVNYKEPTLASKLRRG
DPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVR
EFVSRFPDCRKCKLETHICLR
Sequence length 561
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Oocyte meiosis
  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Atrial And Intestinal Dysrhythmia chronic atrial and intestinal dysrhythmia rs199815268 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Breast Cancer Estrogen-receptor positive breast cancer vs. Estrogen-receptor negative breast cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 32923148
Aneuploidy Associate 25736928, 35044816
Arrhythmias Cardiac Associate 30739867
Carcinogenesis Associate 22161216, 23564482, 38077434
Carcinoma Hepatocellular Associate 25638162
Carcinoma Non Small Cell Lung Associate 22161216, 24146025
Intestinal Pseudo Obstruction Associate 30739867
Leukemia Lymphocytic Chronic B Cell Associate 31278357
Lung Neoplasms Associate 22161216
Neoplasms Associate 24074379