RMDN2 (regulator of microtubule dynamics 2)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID 151393
Gene name Regulator of microtubule dynamics 2
Gene symbol RMDN2
Synonyms (NCBI Gene)
BLOCK18FAM82AFAM82A1PRO34163PYST9371RMD-2RMD2RMD4
Chromosome 2
Chromosome location 2p22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all (19)
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IEA
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611872 26567 ENSG00000115841
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LZ7
Protein name Regulator of microtubule dynamics protein 2 (RMD-2) (hRMD-2) (Protein FAM82A1)
Family and domains
Sequence 
MPYSTNKELILGIMVGTAGISLLLLWYHKVRKPGIAMKLPEFLSLGNTFNSITLQDEIHD
DQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKI
SPQHRARKRRLPTIQSSATSNSSEEAESEGGYITANTDTEEQSFPVPKAFNTRVEELNLD
VLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKKHY
ANIGKTLSERAINRAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLP
EEPFLYYLKGRYCYTVSKLSWIEKKMAATLFGKIPSSTVQEALHNFLKAEELCPGYSNPN
YMYLAKCYTDLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR
Sequence length 410
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Gastric cancer Uncertain significance rs370260752 RCV005931237
Show/Hide Text Mining Associations (11)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 28222213, 29729314, 40363838
Corticobasal Degeneration Associate 29084565
Frontotemporal Dementia Associate 29729314, 30517788, 34057756
Frontotemporal Lobar Degeneration Associate 29729314
Lymphoma Non Hodgkin Associate 8104536
Nerve Degeneration Associate 26220942
Neurodegenerative Diseases Associate 21085657, 29729314, 30720432
Parkinson Disease Associate 29084565
Parkinson Disease Secondary Associate 30517788
Supranuclear Palsy Progressive Associate 29084565, 39251599