Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
151354
Gene name Gene Name - the full gene name approved by the HGNC.
LRAT domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRATD1
Synonyms (NCBI Gene) Gene synonyms aliases
FAM84A, NSE1, PP11517
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p24.3
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IBA
GO:0000902 Process Cell morphogenesis IMP 16820875
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0048870 Process Cell motility IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611234 20743 ENSG00000162981
Protein
UniProt ID Q96KN4
Protein name Protein LRATD1 (LRAT domain-containing 1) (Neurologic sensory protein 1) (NSE1) (Protein FAM84A)
Protein function May play a role in cell morphology and motility.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04970 LRAT 118 225 Lecithin retinol acyltransferase Domain
Tissue specificity TISSUE SPECIFICITY: Only detected in testis. Highly expressed in colon cancer cells. {ECO:0000269|PubMed:16820875}.
Sequence
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPG
CTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALC
EPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNS
WYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKRE
FKAGGEVPAGTQPPQ
QQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Sequence length 292
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Restless Legs Syndrome Restless legs syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cerebral Infarction Associate 37370144