LRATD1 (LRAT domain containing 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 151354
Gene name LRAT domain containing 1
Gene symbol LRATD1
Synonyms (NCBI Gene)
FAM84ANSE1PP11517
Chromosome 2
Chromosome location 2p24.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene Gene ontology Other IDs Protein
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IBA
GO:0000902 Process Cell morphogenesis IMP 16820875
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0048870 Process Cell motility IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
611234 20743 ENSG00000162981
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96KN4
Protein name Protein LRATD1 (LRAT domain-containing 1) (Neurologic sensory protein 1) (NSE1) (Protein FAM84A)
Protein function May play a role in cell morphology and motility.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04970 LRAT 118 → 225 Lecithin retinol acyltransferase Domain
Tissue specificity TISSUE SPECIFICITY: Only detected in testis. Highly expressed in colon cancer cells. {ECO:0000269|PubMed:16820875}.
Sequence 
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPG
CTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALC
EPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNS
WYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQ
QQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Sequence length 292
Interactions View interactions