LRATD1 (LRAT domain containing 1)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
151354
Gene name Gene Name - the full gene name approved by the HGNC.
LRAT domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRATD1
Synonyms (NCBI Gene) Gene synonyms aliases
FAM84A, NSE1, PP11517
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p24.3
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IMP 16820875
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0048870 Process Cell motility IMP 16820875
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611234 20743 ENSG00000162981
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96KN4
Protein name Protein LRATD1 (LRAT domain-containing 1) (Neurologic sensory protein 1) (NSE1) (Protein FAM84A)
Protein function May play a role in cell morphology and motility.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04970 LRAT 118 → 225 Lecithin retinol acyltransferase Domain
Tissue specificity TISSUE SPECIFICITY: Only detected in testis. Highly expressed in colon cancer cells. {ECO:0000269|PubMed:16820875}.
Sequence 
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPG
CTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALC
EPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNS
WYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQ
QQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Sequence length 292
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Multiple Sclerosis Multiple Sclerosis GWAS
Restless Legs Syndrome Restless Legs Syndrome GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Cerebral Infarction Associate 37370144