Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1512
Gene name	Cathepsin H
Gene symbol	CTSH
Synonyms (NCBI Gene)	ACC-4ACC-5ACC4ACC5CPSB
Chromosome	15
Chromosome location	15q25.1
Summary	The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encode

Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022220	hsa-miR-124-3p	Microarray	18668037
MIRT915920	hsa-miR-1178	CLIP-seq
MIRT915921	hsa-miR-1285	CLIP-seq
MIRT915922	hsa-miR-2114	CLIP-seq
MIRT915923	hsa-miR-299-3p	CLIP-seq
MIRT915924	hsa-miR-3150a-3p	CLIP-seq
MIRT915925	hsa-miR-3175	CLIP-seq
MIRT915926	hsa-miR-3180-5p	CLIP-seq
MIRT915927	hsa-miR-3187-5p	CLIP-seq
MIRT915928	hsa-miR-3190	CLIP-seq
MIRT915929	hsa-miR-3689d	CLIP-seq
MIRT915930	hsa-miR-3907	CLIP-seq
MIRT915931	hsa-miR-3978	CLIP-seq
MIRT915932	hsa-miR-4254	CLIP-seq
MIRT915933	hsa-miR-4292	CLIP-seq
MIRT915934	hsa-miR-4308	CLIP-seq
MIRT915935	hsa-miR-4464	CLIP-seq
MIRT915936	hsa-miR-4491	CLIP-seq
MIRT915937	hsa-miR-4505	CLIP-seq
MIRT915938	hsa-miR-4633-3p	CLIP-seq
MIRT915939	hsa-miR-4645-5p	CLIP-seq
MIRT915940	hsa-miR-4657	CLIP-seq
MIRT915941	hsa-miR-4667-5p	CLIP-seq
MIRT915942	hsa-miR-4673	CLIP-seq
MIRT915943	hsa-miR-4700-5p	CLIP-seq
MIRT915944	hsa-miR-4748	CLIP-seq
MIRT915945	hsa-miR-612	CLIP-seq
MIRT915946	hsa-miR-637	CLIP-seq
MIRT915947	hsa-miR-939	CLIP-seq
MIRT915937	hsa-miR-4505	CLIP-seq
MIRT915921	hsa-miR-1285	CLIP-seq
MIRT915926	hsa-miR-3180-5p	CLIP-seq
MIRT915927	hsa-miR-3187-5p	CLIP-seq
MIRT2207340	hsa-miR-4257	CLIP-seq
MIRT915937	hsa-miR-4505	CLIP-seq
MIRT915939	hsa-miR-4645-5p	CLIP-seq
MIRT915942	hsa-miR-4673	CLIP-seq
MIRT915945	hsa-miR-612	CLIP-seq

Show/Hide all (85)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001520	Component	Outer dense fiber	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001656	Process	Metanephros development	ISS
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0001913	Process	T cell mediated cytotoxicity	ISS
GO:0002250	Process	Adaptive immune response	IEP	15196205
GO:0002764	Process	Immune response-regulating signaling pathway	IDA	16822283
GO:0004175	Function	Endopeptidase activity	IDA	14766755, 15127951
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	IDA	15127951
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	6203523
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	2849458
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	ISS
GO:0005515	Function	Protein binding	IPI	6203523, 15127951, 22365146, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9050938, 18216060, 21217776
GO:0005615	Component	Extracellular space	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	1837142, 15196205, 16822283
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	IDA	9050938
GO:0005930	Component	Axoneme	IEA
GO:0006508	Process	Proteolysis	IDA	6203523, 8811434
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2849458
GO:0006915	Process	Apoptotic process	IEA
GO:0006955	Process	Immune response	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008233	Function	Peptidase activity	IDA	18216060
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IDA	8811434, 22365146
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	TAS	2587265
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IBA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	20435891
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	21217776
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	ISS
GO:0010813	Process	Neuropeptide catabolic process	IDA	15127951
GO:0010815	Process	Bradykinin catabolic process	IDA	15127951
GO:0016505	Function	Peptidase activator activity involved in apoptotic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019882	Process	Antigen processing and presentation	TAS	15196205
GO:0030108	Function	HLA-A specific activating MHC class I receptor activity	IDA	16822283
GO:0030335	Process	Positive regulation of cell migration	IDA	21217776
GO:0030984	Function	Kininogen binding	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0031638	Process	Zymogen activation	IDA	20435891
GO:0031638	Process	Zymogen activation	IEA
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	IMP	17500053
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032526	Process	Response to retinoic acid	ISS
GO:0033619	Process	Membrane protein proteolysis	IDA	14766755
GO:0033619	Process	Membrane protein proteolysis	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0042802	Function	Identical protein binding	IEA
GO:0043129	Process	Surfactant homeostasis	IDA	18216060
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IBA
GO:0060448	Process	Dichotomous subdivision of terminal units involved in lung branching	IEA
GO:0060448	Process	Dichotomous subdivision of terminal units involved in lung branching	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070324	Function	Thyroid hormone binding	IDA	21217776
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	21217776
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEA
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEP	21217776
GO:0097208	Component	Alveolar lamellar body	IDA	18216060
GO:0097208	Component	Alveolar lamellar body	IEA
GO:0097486	Component	Multivesicular body lumen	TAS
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905146	Process	Lysosomal protein catabolic process	IDA	15752368
GO:1990834	Process	Response to odorant	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IBA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
116820	2535	ENSG00000103811

P09668

Protein name

Pro-cathepsin H [Cleaved into: Cathepsin H mini chain; Cathepsin H (EC 3.4.22.16); Cathepsin H heavy chain; Cathepsin H light chain]

Protein function

Important for the overall degradation of proteins in lysosomes.

PDB

6CZK , 6CZS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08246	Inhibitor_I29	35 → 90	Cathepsin propeptide inhibitor domain (I29)	Domain
PF00112	Peptidase_C1	116 → 332	Papain family cysteine protease	Domain

Sequence

MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFAS
NWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSV
DWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHG
CQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMV
EAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVK
NSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV

Sequence length

335

Interactions

View interactions

	KEGG		Reactome
	Lysosome Apoptosis		MHC class II antigen presentation Surfactant metabolism Neutrophil degranulation

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CTSH-related disorder	Likely benign	rs144057694, rs11558397	RCV003957151 RCV003932168
Gastric cancer	Likely benign	rs148219875	RCV005903194
Hepatocellular carcinoma	Likely benign	rs148219875	RCV005903193
Lung cancer	Likely benign	rs760230429	RCV005870980
Uterine corpus endometrial carcinoma	Likely benign	rs148219875	RCV005903195
Variant of unknown significance	Uncertain significance	rs886037648	RCV000055656

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abdominal Abscess	Associate	34238216
Adenocarcinoma of Lung	Associate	37507593
Alzheimer Disease	Associate	32413284, 34937778, 37925455, 38527854
Alzheimer Disease	Stimulate	39740768
Amyotrophic Lateral Sclerosis	Associate	32792518
Aneurysm	Associate	18155003
Aortic Aneurysm Abdominal	Associate	11436088
Aortic Aneurysm Familial Abdominal 1	Associate	18155003
Autoimmune Diseases	Associate	32724101
Bipolar Disorder	Associate	21771265
Carcinogenesis	Associate	36982347
Carcinoma Basal Cell	Inhibit	39312365
Carcinoma Hepatocellular	Associate	36982347
Carcinoma Renal Cell	Stimulate	10732746
Carcinoma Renal Cell	Associate	34716619
Carcinoma Squamous Cell	Inhibit	39312365
CD59 Deficiency	Associate	32724101
Colonic Diseases	Stimulate	10755408
Colorectal Neoplasms	Associate	10755408
Diabetes Mellitus Type 1	Associate	21270831, 22825589, 25743184, 31558544, 33992646
Diabetes Mellitus Type 2	Associate	22825589
Drug Related Side Effects and Adverse Reactions	Associate	40226625
Frontotemporal Dementia	Associate	32792518
Gallbladder Neoplasms	Associate	24657443
Graft vs Host Disease	Associate	16822283
Inflammatory Breast Neoplasms	Inhibit	18949742
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	27534394
Lewy Body Disease	Associate	38527854
Lung Diseases	Associate	23483898
Lung Neoplasms	Associate	10732746, 37471639
Lung Neoplasms	Stimulate	37679517
Melanoma	Inhibit	39312365
Narcolepsy	Associate	25743184
Neoplasms	Associate	10732746, 10755408, 11796715, 16822283, 32721119, 36982347, 37507593
Pancreatic Neoplasms	Associate	8641471
Polycystic Kidney Autosomal Dominant	Associate	9066978
Prostatic Intraepithelial Neoplasia	Stimulate	11796715
Prostatitis	Associate	11796715
Pulmonary Alveolar Proteinosis	Associate	18216060
Rheumatic Fever	Associate	40226625
Skin Neoplasms	Inhibit	39312365
Status Asthmaticus	Associate	23483898

CTSH (cathepsin H)